.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pf5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.5A crystal structure of protein YJGH from E. Coli. To be Published
    Site MCSG
    PDB Id 1pf5 Target Id APC5516
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4673,NP_418669, 562 Molecular Weight 14589.49 Da.
    Residues 131 Isoelectric Point 4.58
    Sequence mvertavfpagrhslyaehrysaairsgdllfvsgqvgsredgtpepdfqqqvrlafdnlhatlaaagc tfddiidvtsfhtdpenqfedimtvkneifsappypnwtavgvtwlagfdfeikviaripeq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.218
    Matthews' coefficent Rfactor 0.196
    Waters 71 Solvent Content

    Ligand Information
    Ligands
    Metals HG (MERCURY) x 1

    Jmol

     
    Google Scholar output for 1pf5
    1. A phylogenetic view of bacterial ribonucleases
    A Danchin - Progress in molecular biology and translational , 2009 - Elsevier
     
    2. Structural Studies of Thiamin Monophosphate Kinase in Complex with Substrates and Products,
    KM McCulloch, C Kinsland, TP Begley, SE Ealick - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch