.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional similarities between phage lambda Orf and Escherichia coli RecFOR in initiation of genetic exchange. Proc.Natl.Acad.Sci.USA 102 11260-11265 2005
    Site MCSG
    PDB Id 1pc6 Target Id APC3010
    Molecular Characteristics
    Source Bacteriophage lambda
    Alias Ids TPS4590,NP_040634, 10710 Molecular Weight 16647.21 Da.
    Residues 146 Isoelectric Point 9.10
    Sequence mkkltfeirspahqqnaihavqqilpdptkpivvtiqernrsldqnrklwaclgdvsrqvewhgrwlda eswkcvftaalkqqdvvpnlagngfvvigqstsrmrvgefaelleliqafgtergvkwsdearlalewk arwgdraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.51 Rfree 0.294
    Matthews' coefficent 2.74 Rfactor 0.234
    Waters 29 Solvent Content 55.10

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1pc6
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. The RAGNYA fold: a novel fold with multiple topological variants found in functionally diverse nucleic acid, nucleotide and peptide-binding proteins
    S Balaji, L Aravind - Nucleic acids research, 2007 - Oxford Univ Press
     
    3. Functional similarities between phage _ Orf and Escherichia coli RecFOR in initiation of genetic exchange
    KL Maxwell, P Reed, R Zhang - Proceedings of the , 2005 - National Acad Sciences
     
    4. The C_terminus of the phage _ Orf recombinase is involved in DNA binding
    FA Curtis, P Reed, LA Wilson - Journal of Molecular , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch