.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pbt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure analysis of TM1154, oxidoreductase from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 1pbt Target Id APC4602
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4618,AAD36230, 2336 Molecular Weight 25323.86 Da.
    Residues 220 Isoelectric Point 6.35
    Sequence mektviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpvyeklaeqkfpwnrihfflsde ryvpldsdqsnfrninevlfsrakipsgnvhyvdtslpiekacekyereirsatdqfdlailgmgpdgh vasifdletgnkdnlvtftdpsgdpkvprvtltfralntslyvlflirgkekinrlteilkdtplpayf vrgkektvwfvgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.225
    Matthews' coefficent 1.86 Rfactor 0.179
    Waters 330 Solvent Content 33.75

    Ligand Information
    Ligands SO4 (SULFATE) x 2;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;EDO (1,2-ETHANEDIOL) x 1;FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1pbt
    1. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    2. Division of labor among the yeast Sol proteins implicated in tRNA nuclear export and carbohydrate metabolism
    DR Stanford, ML Whitney, RL Hurto, DM Eisaman - , 2004 - Genetics Soc America
     
    3. Three Dimensional Structure and Implications for the Catalytic Mechanism of 6-Phosphogluconolactonase from Trypanosoma brucei
    M Delarue, N Duclert-Savatier, E Miclet - Journal of molecular , 2007 - Elsevier
     
    4. Crystal structures of the effector_binding domain of repressor Central glycolytic gene Regulator from Bacillus subtilis reveal ligand_induced structural changes upon
    P _ez_ov, M Koek, SF Moy - Molecular , 2008 - Wiley Online Library
     
    5. Determination of dihedral _ angles in large proteins by combining NHN/C_H_ dipole/dipole cross_correlation and chemical shifts
    K Loth, D Abergel, P Pelupessy - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. Insights into the enzymatic mechanism of 6-phosphogluconolactonase from Trypanosoma brucei using structural data and molecular dynamics simulation
    N Duclert-Savatier, L Poggi, E Miclet, P Lopes - Journal of molecular , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch