.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p99

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The membrane-associated lipoprotein-9 GmpC from Staphylococcus aureus binds the dipeptide GlyMet via side chain interactions. Biochemistry 43 16193-16202 2004
    Site MCSG
    PDB Id 1p99 Target Id APC009
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS4411,BAB41652, 1280 Molecular Weight 30484.44 Da.
    Residues 280 Isoelectric Point 9.02
    Sequence mkrliglvivalvllaacgsnndkkvtigvasndtkawekvkelakkddidveikhfsdynlpnkalnd gdidmnafqhfafldqykkahkgtkisalsttvlaplgiysdkikdvkkvkdgakvvipndvsnqaral klleaagliklkkdfglagtvkditsnpkhlkitavdaqqtaralsdvdiavinngvatkagkdpkndp ifleksnsdavkpyinivavndkdldnktyakivelyhskeaqkalqedvkdgekpvnlskdeikaiet slak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.236
    Matthews' coefficent 2.12 Rfactor 0.2
    Waters 292 Solvent Content 42.02

    Ligand Information
    Ligands GLY-MET x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch