| Title | Crystal Structure Analysis of Thermotoga maritima protein TM1620 (APC4843). To be Published | | Site | MCSG | | PDB Id | | Target Id | APC4843 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS4627,AAD36687, 2336 | Molecular Weight | 13788.25 Da. | | Residues | 121 | Isoelectric Point | 6.15 | | Sequence | meykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvr cvqegasdeeifealdialvvggsiviphlrravgfleelremekngetisl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 5 | | Resolution (Å) | 2.30 | Rfree | 0.29 | | Matthews' coefficent | 1.85 | Rfactor | 0.225 | | Waters | 87 | Solvent Content | 33.68 |
| Ligand Information | | Ligands | | | Metals | | | |
