.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p8c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of Thermotoga maritima protein TM1620 (APC4843). To be Published
    Site MCSG
    PDB Id 1p8c Target Id APC4843
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4627,AAD36687, 2336 Molecular Weight 13788.25 Da.
    Residues 121 Isoelectric Point 6.15
    Sequence meykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvr cvqegasdeeifealdialvvggsiviphlrravgfleelremekngetisl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.30 Rfree 0.29
    Matthews' coefficent 1.85 Rfactor 0.225
    Waters 87 Solvent Content 33.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1p8c
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. Evolution of protein fold in the presence of functional constraints
    A Andreeva, AG Murzin - Current opinion in structural biology, 2006 - Elsevier
     
    3. SISYPHUSstructural alignments for proteins with non-trivial relationships
    A Andreeva, A Prli_, TJP Hubbard - Nucleic acids , 2007 - Oxford Univ Press
     
    4. Crystal structure of the conserved protein TTHA0727 from Thermus thermophilus HB8 at 1.9 resolution: A CMD family member distinct from carboxymuconolactone
    K Ito, R Arai, E Fusatomi, T Kamo_Uchikubo - Protein , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch