| Title | The 2 A crystal structure of protein paaC from E. Coli. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5022 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4638,AAC74472, 562 | Molecular Weight | 27875.97 Da. | | Residues | 248 | Isoelectric Point | 4.89 | | Sequence | mnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelagegdedtla ftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaaisakaikearyhlrfsr gwlerlgngtdvsgqkmqqainklwrftaelfdadeidialseegiavdprtlraaweaevfagineat lnvpqeqayrtggkkglhtehlgpmlaemqylqrvlpgqqw | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.229 | | Matthews' coefficent | 3.22 | Rfactor | 0.194 | | Waters | 342 | Solvent Content | 61.78 |
| Ligand Information | | Ligands | | | Metals | | | |
