.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nr9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli Putative Isomerase EC1262 (APC5008). To be Published
    Site MCSG
    PDB Id 1nr9 Target Id APC5008
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4635,NP_415698, 562 Molecular Weight 23709.88 Da.
    Residues 219 Isoelectric Point 5.88
    Sequence myqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqplaipsdfgsvhh evelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscplsgfipaae ftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvltgtpdgvgplqsgdeltv tfdghslttrvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.275
    Matthews' coefficent 2.42 Rfactor 0.206
    Waters 277 Solvent Content 49.08

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1nr9
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. X-ray structure of fumarylacetoacetate hydrolase family member Homo sapiens FLJ36880
    BA Manjasetty, FH Niesen, H Delbruck, F Gotz - Biological , 2004 - molgen.mpg.de
     
    3. Structural Insight into Substrate Binding and Catalysis of a Novel 2-Keto-3- deoxy-d-arabinonate Dehydratase Illustrates Common Mechanistic Features of the
    SJJ Brouns, TRM Barends, P Worm, J Akerboom - Journal of molecular , 2008 - Elsevier
     
    4. Structure and Mechanism of HpcG, a Hydratase in the Homoprotocatechuate Degradation Pathway of Escherichia coli
    A Izumi, D Rea, T Adachi, S Unzai, SY Park - Journal of molecular , 2007 - Elsevier
     
    5. The impact of Structural Proteomics on Biotechnology
    BA Manjasetty, AP Turnbull - and Genetic Engineering , 2010 - ingentaconnect.com
     
    6. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch