| Title | Crystal Structure of Escherichia coli Putative Isomerase EC1262 (APC5008). To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5008 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4635,NP_415698, 562 | Molecular Weight | 23709.88 Da. | | Residues | 219 | Isoelectric Point | 5.88 | | Sequence | myqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqplaipsdfgsvhh evelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscplsgfipaae ftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvltgtpdgvgplqsgdeltv tfdghslttrvl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.70 | Rfree | 0.275 | | Matthews' coefficent | 2.42 | Rfactor | 0.206 | | Waters | 277 | Solvent Content | 49.08 |
| Ligand Information | | Ligands | | | Metals | MG (MAGNESIUM) x 4 | | |
