.
The Open Protein Structure Annotation Network
PDB Keyword
.

1npy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Novel Shikimate Dehydrogenase from Haemophilus influenzae. J.Biol.Chem. 280 17101-17108 2005
    Site MCSG
    PDB Id 1npy Target Id APC409
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS4470,P44774, 727 Molecular Weight 29930.87 Da.
    Residues 271 Isoelectric Point 8.59
    Sequence minkdtqlcmslsgrpsnfgttfhnylydklglnfiykafttqdiehaikgvralgirgcavsmpfket cmpfldeihpsaqaiesvntivndngflrayntdyiaivkliekyhlnknakvivhgsggmakavvaaf knsgfeklkiyarnvktgqylaalygyayinslenqqadilvnvtsigmkggkeemdlafpkafidnas vafdvvampvetpfiryaqargkqtisgaavivlqaveqfelythqrpsdeliaeaaafartkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.75 Rfree 0.21908
    Matthews' coefficent 2.30 Rfactor 0.17934
    Waters 1149 Solvent Content 46.46

    Ligand Information
    Ligands ACE (ACETYL) x 3
    Metals

    Jmol

     
    Google Scholar output for 1npy
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    3. Exploring structurally conserved solvent sites in protein families
    CA Bottoms, TA White, JJ Tanner - : Structure, Function, and , 2006 - Wiley Online Library
     
    4. Predicting small ligand binding sites in proteins using backbone structure
    AJ Bordner - Bioinformatics, 2008 - Oxford Univ Press
     
    5. Site-directed mutagenesis of the active site region in the quinate/shikimate 5-dehydrogenase YdiB of Escherichia coli
    HA Lindner, G Nadeau, A Matte, G Michel - Journal of Biological , 2005 - ASBMB
     
    6. Crystal structures of shikimate dehydrogenase AroE from Thermus thermophilus HB8 and its cofactor and substrate complexes: insights into the enzymatic mechanism
    B Bagautdinov, N Kunishima - Journal of molecular biology, 2007 - Elsevier
     
    7. Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism
    J Gan, Y Wu, P Prabakaran, Y Gu, Y Li - Biochemistry, 2007 - ACS Publications
     
    8. Identification of family-specific residue packing motifs and their use for structure-based protein function prediction: II. Case studies and applications
    D Bandyopadhyay, J Huan, J Prins, J Snoeyink - Journal of computer- , 2009 - Springer
     
    9. Structural and mechanistic analysis of a novel class of shikimate dehydrogenase: Evidence for a conserved catalytic mechanism in the shikimate dehydrogenase
    J Peek, J Lee, S Hu, G Senisterra, D Christendat - Biochemistry, 2011 - ACS Publications
     
    10. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     
    11. Bioinformatics of protein bound water
    CA Bottoms - 2005 - mospace.umsystem.edu
     
    12. Deciphering the Arginine-Binding Preferences at the Substrate-Binding Groove of Ser/Thr Kinases by Computational Surface Mapping
    A Ben-Shimon, MY Niv - PLoS Computational Biology, 2011 - dx.plos.org
     
    13. POSOLE: Automated Ontological Annotation for Function Prediction
    K Verspoor, J Cohn, S Mniszewski - Automated Function , 2005 - biofunctionprediction.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch