.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nni

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Azobenzene Reductase from Bacillus subtilis. To be Published 2003
    Site MCSG
    PDB Id 1nni Target Id APC1167
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4507,O07529, 1423 Molecular Weight 18902.89 Da.
    Residues 174 Isoelectric Point 6.43
    Sequence mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvtkadaivl lspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvmrgvyanvipkqlvldp vhidvenatvaenikesikelveelsmfakagnpgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.238
    Matthews' coefficent 3.99 Rfactor 0.221
    Waters 138 Solvent Content 68.90

    Ligand Information
    Ligands FMN (FLAVIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1nni
    1. Biochemical and molecular characterization of an azoreductase from Staphylococcus aureus, a tetrameric NADPH-dependent flavoprotein
    H Chen, SL Hopper, CE Cerniglia - Microbiology, 2005 - Soc General Microbiol
     
    2. Recent advances in azo dye degrading enzyme research
    H Chen - Current Protein and Peptide Science, 2006 - ingentaconnect.com
     
    3. Structure of cytochrome p450s and personalized drug
    JF Wang, CC Zhang, KC Chou - Current medicinal , 2009 - ingentaconnect.com
     
    4. A less laborious approach to the high-throughput production of recombinant proteins in Escherichia coli using 2-liter plastic bottles
    C Sanville Millard, L Stols, P Quartey, Y Kim - Protein expression and , 2003 - Elsevier
     
    5. Flavin-dependent quinone reductases
    S Deller, P Macheroux, S Sollner - Cellular and molecular life sciences, 2008 - Springer
     
    6. Structure determination of an FMN reductase from Pseudomonas aeruginosa PA01 using sulfur anomalous signal
    R Agarwal, JB Bonanno, SK Burley - Section D: Biological , 2006 - scripts.iucr.org
     
    7. Crystal structure of an aerobic FMN-dependent azoreductase (AzoA) from Enterococcus faecalis
    ZJ Liu, H Chen, N Shaw, SL Hopper, L Chen - Archives of biochemistry , 2007 - Elsevier
     
    8. Characterization of a thermostable NADPH: FMN oxidoreductase from the mesophilic bacterium Bacillus subtilis
    S Deller, S Sollner, R Trenker-El-Toukhy - Biochemistry, 2006 - ACS Publications
     
    9. Azoreductase from Rhodobacter sphaeroides AS1. 1737 is a flavodoxin that also functions as nitroreductase and flavin mononucleotide reductase
    G Liu, J Zhou, H Lv, X Xiang, J Wang, M Zhou - Applied microbiology and , 2007 - Springer
     
    10. Crystal structure of the NADH: quinone oxidoreductase WrbA from Escherichia coli
    SLA Andrade, EV Patridge, JG Ferry - Journal of , 2007 - Am Soc Microbiol
     
    11. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     
    12. A single intersubunit salt bridge affects oligomerization and catalytic activity in a bacterial quinone reductase
    A Binter, N Staunig, I Jelesarov, K Lohner - FEBS , 2009 - Wiley Online Library
     
    13. Lateral gene transfer in phylogeny of azoreductase enzyme
    A Bafana, T Chakrabarti - Computational Biology and Chemistry, 2008 - Elsevier
     
    14. In Silico identification of catalytic residues in azobenzene reductase from bacillus subtilis and its docking studies with azo dyes
    K Ramanathan, V Shanthi - Interdisciplinary Sciences: , 2009 - Springer
     
    15. Structure Determination and Functional Analysis of a Chromate Reductase from Gluconacetobacter hansenii
    H Jin, Y Zhang, GW Buchko, SM Varnum, H Robinson - PloS one, 2012 - dx.plos.org
     
    16. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch