| Title | The 2.2 A resolution structure of RpiB/AlsB from Escherichia coli illustrates a new approach to the ribose-5-phosphate isomerase reaction. J.Mol.Biol. 332 1083-1094 2003 | | Site | MCSG | | PDB Id | | Target Id | APC072 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4437,AAC77051, 562 | Molecular Weight | 16072.49 Da. | | Residues | 149 | Isoelectric Point | 6.58 | | Sequence | mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevdggilicgtg vgisiaankfagiravvcsepysaqlsrqhndtnvlafgsrvvglelakmivdawlgaqyeggrhqqrv eaitaieqrrn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.20 | Rfree | 0.262 | | Matthews' coefficent | 2.83 | Rfactor | 0.216 | | Waters | 298 | Solvent Content | 56.59 |
| Ligand Information | | Ligands | | | Metals | | | |
