.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ng5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of sortase B from Staphylococcus aureus and Bacillus anthracis reveal catalytic amino acid triad in the active site. Structure 12 1147-1156 2004
    Site MCSG
    PDB Id 1ng5 Target Id APC010
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS4412,BAB42231, 1280 Molecular Weight 29134.05 Da.
    Residues 244 Isoelectric Point 8.84
    Sequence mrmkrfltivqillvviiiifgykivqtyiedkqeranyeklqqkfqmlmskhqehvrpqfeslekink divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmf dvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvins dvnvtvkdkimtlstcedaysettkrivvvakiikvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.248
    Matthews' coefficent 2.11 Rfactor 0.237
    Waters 307 Solvent Content 41.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ng5
    1. Structures of Sortase B from Staphylococcus aureus and Bacillus anthracis Reveal Catalytic Amino Acid Triad in the Active Site
    R Zhang, R Wu, G Joachimiak, SK Mazmanian - Structure, 2004 - Elsevier
     
    2. Sortase transpeptidases: insights into mechanism, substrate specificity, and inhibition
    KW Clancy, JA Melvin, DG McCafferty - Peptide Science, 2010 - Wiley Online Library
     
    3. Benefits of structural genomics for drug discovery research
    M Grabowski, M Chruszcz, MD Zimmerman - disorders drug targets, 2009 - ncbi.nlm.nih.gov
     
    4. Crystal structure of Spy0129, a Streptococcus pyogenes class B sortase involved in pilus assembly
    HJ Kang, F Coulibaly, T Proft, EN Baker - PloS one, 2011 - dx.plos.org
     
    5. Sortase enzymes in Gram_positive bacteria
    T Spirig, EM Weiner, RT Clubb - Molecular microbiology, 2011 - Wiley Online Library
     
    6. Sortase Pathways in Gram-Positive Bacteria
    KM Connolly, RT Clubb - Structural biology of bacterial , 2005 - books.google.com
     
    7. Molecular recognition and catalysis in sortase A from Staphylococcus aureus
    ML Bentley - 2009 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch