| Title | Structures of sortase B from Staphylococcus aureus and Bacillus anthracis reveal catalytic amino acid triad in the active site. Structure 12 1147-1156 2004 | | Site | MCSG | | PDB Id | | Target Id | APC010 | | Molecular Characteristics | | Source | Staphylococcus aureus | | Alias Ids | TPS4412,BAB42231, 1280 | Molecular Weight | 29134.05 Da. | | Residues | 244 | Isoelectric Point | 8.84 | | Sequence | mrmkrfltivqillvviiiifgykivqtyiedkqeranyeklqqkfqmlmskhqehvrpqfeslekink divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmf dvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvins dvnvtvkdkimtlstcedaysettkrivvvakiikvs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.248 | | Matthews' coefficent | 2.11 | Rfactor | 0.237 | | Waters | 307 | Solvent Content | 41.59 |
| Ligand Information | | Ligands | | | Metals | | | |
