| Title | Crystal Structure Analysis of Thermotoga maritima Hypothetical protein TM1070. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC4568 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS4612,AAD36147, 2336 | Molecular Weight | 13060.55 Da. | | Residues | 114 | Isoelectric Point | 7.79 | | Sequence | mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveispmkslhlrld klgipkckpysimaesnvpvvmqlsrldvgknhytlmttigywee | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.55 | Rfree | 0.19 | | Matthews' coefficent | 1.93 | Rfactor | 0.1696 | | Waters | 526 | Solvent Content | 36.37 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 3;FMT (FORMIC) x 4 | | Metals | CL (CHLORIDE) x 2;MG (MAGNESIUM) x 4 | | |
