.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mkz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J.Biol.Chem. 279 42139-42146 2004
    Site MCSG
    PDB Id 1mkz Target Id APC063
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4431,AAC73869, 562 Molecular Weight 18664.08 Da.
    Residues 170 Isoelectric Point 5.73
    Sequence msqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvsawiasdd vqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsravagvanktlifampg stkacrtaweniiapqldartrpcnfhphlkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.21871
    Matthews' coefficent 2.30 Rfactor 0.18284
    Waters 235 Solvent Content 46.53

    Ligand Information
    Ligands SO4 (SULFATE) x 7;ACY (ACETIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch