.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mkz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J.Biol.Chem. 279 42139-42146 2004
    Site MCSG
    PDB Id 1mkz Target Id APC063
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4431,AAC73869, 562 Molecular Weight 18664.08 Da.
    Residues 170 Isoelectric Point 5.73
    Sequence msqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvsawiasdd vqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsravagvanktlifampg stkacrtaweniiapqldartrpcnfhphlkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.21871
    Matthews' coefficent 2.30 Rfactor 0.18284
    Waters 235 Solvent Content 46.53

    Ligand Information
    Ligands SO4 (SULFATE) x 7;ACY (ACETIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 1mkz
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Function of MoaB proteins in the biosynthesis of the molybdenum and tungsten cofactors
    LE Bevers, PL Hagedoorn, JA Santamaria-Araujo - Biochemistry, 2008 - ACS Publications
     
    3. Crystal structures, dynamics and functional implications of molybdenum-cofactor biosynthesis protein MogA from two thermophilic organisms
    SP Kanaujia, J Jeyakanthan, A Shinkai - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Exploring synonymous codon usage preferences of disulfide-bonded and non-disulfide bonded cysteines in the E. coli genome
    J Song, M Wang, K Burrage - Journal of theoretical biology, 2006 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch