.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mkm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family. J.Biol.Chem. 277 19183-19190 2002
    Site MCSG
    PDB Id 1mkm Target Id APC048
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4427,AAD35159, 2336 Molecular Weight 28117.25 Da.
    Residues 246 Isoelectric Point 8.65
    Sequence mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvpgyklieygs fvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystasgks ilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigimcvgvpifdhngy pvagvsisgvarkfteekieeysdvlkekaeeisrklgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.3
    Matthews' coefficent 2.78 Rfactor 0.232
    Waters 111 Solvent Content 55.71

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1jmr.png
    No description
    30.59 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch