.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mki

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis. Biochemistry 47 5724-5735 2008
    Site MCSG
    PDB Id 1mki Target Id APC1040
    Related PDB Ids 2osu 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4483,O31465, 1423 Molecular Weight 36184.67 Da.
    Residues 327 Isoelectric Point 5.43
    Sequence mkelikehqkdinpalqlhdwveyyrpfaangqsanyipalgkvndsqlgicvlepdgtmihagdwnvs ftmqsiskvisfiaacmsrgipyvldrvdveptgdafnsiirleinkpgkpfnpminagaltiasilpg esayekleflysvmetligkrpriheevfrsewetahrnralayylketnfleaeveetlevylkqcam esttedialiglilahdgyhpirheqvipkdvaklakalmltcgmynasgkyaafvgvpaksgvsggim alvppsarreqpfqsgcgigiygpaideygnsltggmllkhmaqewelsif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 2.24 Rfactor 0.212
    Waters 330 Solvent Content 45.14

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4;FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1mki
    1. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    2. From protein structure to biochemical function?
    RA Laskowski, JD Watson, JM Thornton - Journal of structural and , 2003 - Springer
     
    3. Conformational changes in protein loops and helices induced by post-translational phosphorylation
    ES Groban, A Narayanan, MP Jacobson - PLoS computational biology, 2006 - dx.plos.org
     
    4. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    5. Functional and Structural Characterization of Four Glutaminases from Escherichia coli and Bacillus subtilis
    G Brown, A Singer, M Proudfoot, T Skarina, Y Kim - Biochemistry, 2008 - ACS Publications
     
    6. Crystal structure of a major fragment of the salt-tolerant glutaminase from Micrococcus luteus K-3
    K Yoshimune, Y Shirakihara, A Shiratori - Biochemical and , 2006 - Elsevier
     
    7. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    8. Crystal structure of salt_tolerant glutaminase from Micrococcus luteus K_3 in the presence and absence of its product l_glutamate and its activator Tris
    K Yoshimune, Y Shirakihara, M Wakayama - FEBS , 2010 - Wiley Online Library
     
    9. Analysis of essential amino acid residues for catalytic activity of glutaminase from Micrococcus luteus K-3
    S Yano, A Kamemura, K Yoshimune - Journal of bioscience , 2006 - Elsevier
     
    10. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    11. Molecular replacement: the probabilistic approach of the program REMO09 and its applications
    R Caliandro, B Carrozzini, GL Cascarano - A: Foundations of , 2009 - scripts.iucr.org
     
    12. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    13. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch