.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli. J.Biol.Chem. 278 26039-26045 2003
    Site MCSG
    PDB Id 1m33 Target Id APC064
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4432,AAC76437, 562 Molecular Weight 28503.51 Da.
    Residues 256 Isoelectric Point 6.50
    Sequence mnniwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsladmaeavl qqapdkaiwlgwslgglvasqialthpervqalvtvasspcfsardewpgikpdvlagfqqqlsddfqr tverflalqtmgtetarqdaralkktvlalpmpevdvlnggleilktvdlrqplqnvsmpflrlygyld glvprkvvpmldklwphsesyifakaahapfishpaefchllvalkqrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.18838
    Matthews' coefficent 2.40 Rfactor 0.14523
    Waters 252 Solvent Content 48.81

    Ligand Information
    Ligands 3OH (3-HYDROXY-PROPANOIC) x 1;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1m33
    1. Predicting protein function from sequence and structural data
    JD Watson, RA Laskowski, JM Thornton - Current opinion in structural , 2005 - Elsevier
     
    2. Integrating Structure, Bioinformatics, and Enzymology to Discover Function BioH, A NEW CARBOXYLESTERASE FROM ESCHERICHIA COLI
    R Sanishvili, AF Yakunin, RA Laskowski - Journal of Biological , 2003 - ASBMB
     
    3. Effective function annotation through catalytic residue conservation
    RA George, RV Spriggs, GJ Bartlett - Proceedings of the , 2005 - National Acad Sciences
     
    4. pvSOAR: detecting similar surface patterns of pocket and void surfaces of amino acid residues on proteins
    TA Binkowski, P Freeman, J Liang - Nucleic acids research, 2004 - Oxford Univ Press
     
    5. Protein surface analysis for function annotation in high_throughput structural genomics pipeline
    TA Binkowski, A Joachimiak, J Liang - Protein science, 2005 - Wiley Online Library
     
    6. Crystal structures of RsbQ, a stress_response regulator in Bacillus subtilis
    T Kaneko, N Tanaka, T Kumasaka - Protein science, 2005 - Wiley Online Library
     
    7. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    8. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    9. Application of a sensitive collection heuristic for very large protein families: evolutionary relationship between adipose triglyceride lipase (ATGL) and classic
    G Schneider, G Neuberger, M Wildpaner - BMC , 2006 - biomedcentral.com
     
    10. Towards the prediction of protein interaction partners using physical docking
    MN Wass, G Fuentes, C Pons, F Pazos - Molecular systems , 2011 - nature.com
     
    11. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    12. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    13. A seqlet-based maximum entropy Markov approach for protein secondary structure prediction
    Q Dong, X Wang, L Lin, Y Guan - Science in China Series C: Life Sciences, 2005 - Springer
     
    14. Alteration of oligomeric state and domain architecture is essential for functional transformation between transferase and hydrolase with the same scaffold
    R Koike, A Kidera, M Ota - Protein Science, 2009 - Wiley Online Library
     
    15. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    16. Protein structure-based method for identifying horizontal gene transfer
    VRB Santosh, MA Griep, PZ Revesz - Proceedings of The Fourth , 2011 - dl.acm.org
     
    17. Identifying Horizontal Gene Transfer Using Anomalies In Protein Structures And Sequences
    VRB Santosh - 2011 - digitalcommons.unl.edu
     
    18. Oriented adsorptive immobilization of esterase BioH based on protein structure analysis
    G Ren, H Yu - Biochemical Engineering Journal, 2011 - Elsevier
     
    19. Evolution of a new function in an esterase: simple amino acid substitutions enable the activity present in the larger paralog, BioH
    H Flores, S Lin, G Contreras-Ferrat - Protein Engineering , 2012 - Oxford Univ Press
     
    20. Structural bioinformatics: from protein structure to function
    AM Edwards, JD Watson, A Golovin - Evolving Methods for , 2007 - Springer
     
    21. STRUCTURAL BIOINFORMATICS: FROM PROTEIN STRUCTURE TO FUNCTION
    JD WATSON, A GOLOVIN - Evolving methods for , 2007 - books.google.com
     
    22. COMPARISON OF MULTIPLE SEQUENCE ALIGNMENT PROGRAMS IN PRACTISE
    NT Hang - 2008 - cs.au.dk
     
    23. Computational tools for molecular epidemiology and computational genomics of neisseria meningitidis
    LS Katz - 2010 - smartech.gatech.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch