| Title | Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli. J.Biol.Chem. 278 26039-26045 2003 | | Site | MCSG | | PDB Id | | Target Id | APC064 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4432,AAC76437, 562 | Molecular Weight | 28503.51 Da. | | Residues | 256 | Isoelectric Point | 6.50 | | Sequence | mnniwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsladmaeavl qqapdkaiwlgwslgglvasqialthpervqalvtvasspcfsardewpgikpdvlagfqqqlsddfqr tverflalqtmgtetarqdaralkktvlalpmpevdvlnggleilktvdlrqplqnvsmpflrlygyld glvprkvvpmldklwphsesyifakaahapfishpaefchllvalkqrv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.18838 | | Matthews' coefficent | 2.40 | Rfactor | 0.14523 | | Waters | 252 | Solvent Content | 48.81 |
| Ligand Information | | Ligands | 3OH (3-HYDROXY-PROPANOIC) x 1;EDO (1,2-ETHANEDIOL) x 2 | | Metals | | | |
