.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l7a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of the Cephalosporin C deacetylase. To be Published
    Site MCSG
    PDB Id 1l7a Target Id APC1052
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4487,P94388, 1423 Molecular Weight 35804.75 Da.
    Residues 318 Isoelectric Point 5.52
    Sequence mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrltyksfgnari tgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgqqssedtsisphghalgwm tkgildkdtyyyrgvyldavralevissfdevdetrigvtggsqgggltiaaaalsdipkaavadypyl snferaidvaleqpyleinsffrrngspetevqamktlsyfdimnladrvkvpvlmsiglidkvtppst vfaaynhletkkelkvyryfgheyipafqteklaffkqhlkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.189
    Matthews' coefficent 2.16 Rfactor 0.185
    Waters 503 Solvent Content 43.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1l7a
    1. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    2. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    3. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    4. Structural classification by the Lipase Engineering Database: a case study of Candida antarctica lipase A
    M Widmann, PB Juhl, J Pleiss - BMC genomics, 2010 - biomedcentral.com
     
    5. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    6. Recognition of Interaction Interface Residues in Low-Resolution Structures of Protein Assemblies Solely from the Positions of C_ Atoms
    RA Gadkari, D Varughese, N Srinivasan - PloS one, 2009 - dx.plos.org
     
    7. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    8. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    9. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    10. Synthesis of functionalized furopyrazines as restricted dipeptidomimetics
    S Claerhout, S Sharma, C Skld, C Cavaluzzo - Tetrahedron, 2012 - Elsevier
     
    11. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    12. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    13. Hyperthermostable acetyl xylan esterase
    K Drzewiecki, A Angelov, M Ballschmiter - Microbial , 2010 - Wiley Online Library
     
    14. Dead_End elimination with perturbations (DEEPer): A provable protein design algorithm with continuous sidechain and backbone flexibility
    MA Hallen, DA Keedy - : Structure, Function, and , 2012 - Wiley Online Library
     
    15. Computational investigations of enzyme catalysis, design, and conformational aspects of drug-target interactions
    AJT Smith - 2008 - books.google.com
     
    16. Integrating sequence and structure data for identifying functional sites on protein structures
    MHP Liang - 2005 - bmir.stanford.edu
     

    Protein Summary

    The cah gene of Bacillus subtilis encodes a cephalosporin C deacetylase (CAH) (EC 3.1.1.41), an enzyme that hydrolyses the acetyl ester bond on the 10-position of the antibiotic cephalosporin C. The structure forms a single three-layered a/b/a domain that belongs to the alpha/beta hydrolase fold shared by acetyl xylan esterases (AXEs) (EC 3.1.1.72, PF05448) (PDB id: 1vlq), enzymes that deacetylase xylan, a major component of lignocellulose, and xylo-oligosaccharides. The two enzymes have identical tertiary (main chain rmsd 1.3 Å over 325 residues, 40% sequence identity) and quaternary structures (dimer of trimers).


    It has been suggested that CAHs and AXEs represent a single class of proteins exhibiting a multifunctional deacetylase activity against a range of small substrates (Vincent 2003). By analogy with self-compartentalising proteases, oligomerization of CAHs and AXEs has been proposed to shield their active sites with a narrow tunnel leading to the center of the molecule and the six active-center catalytic triads pointing towards the tunnel interior, thus sequestered away from cytoplasmic contents (Vincent 2003).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch