| Title | The crystal structure of hypothetical protein MTH1491 from Methanobacterium thermoautotrophicum. Protein Sci. 11 1409-1414 2002 | | Site | MCSG | | PDB Id | | Target Id | APC079 | | Molecular Characteristics | | Source | Methanobacterium thermoautotrophicum | | Alias Ids | TPS4442,G69065, 145262 | Molecular Weight | 12552.44 Da. | | Residues | 113 | Isoelectric Point | 4.57 | | Sequence | mvdyrvvfhideddesrvlllisnvrnlmadlesvrievvaysmgvnvlrrdseysgdvseltgqgvrf cacsntlrasgmdgddllegvdvvssgvghivrrqtegwayirp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.226 | | Matthews' coefficent | 2.85 | Rfactor | 0.202 | | Waters | 19 | Solvent Content | 56.83 |
| Ligand Information | | Ligands | | | Metals | | | |
