.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kyt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermoplasma acidophilum 0175 (APC014). To be published
    Site MCSG
    PDB Id 1kyt Target Id APC014
    Related PDB Ids 1l6r 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4414,CAC11321, 2303 Molecular Weight 25277.37 Da.
    Residues 224 Isoelectric Point 5.03
    Sequence mirlaaidvdgtltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgingpvfgenggi mfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpedvdyvrkeaesrgfvifys gyswhlmnrgedkafavnklkemysleydeilvigdsnndmpmfqlpvrkacpanatdnikavsdfvsd ysygeeigqifkhfelm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.246
    Matthews' coefficent 2.40 Rfactor 0.224
    Waters 437 Solvent Content 48.84

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 1kyt
    1. Crystal structure of trehalose_6_phosphate phosphataserelated protein: Biochemical and biological implications
    KN Rao, D Kumaran, J Seetharaman - Protein , 2006 - Wiley Online Library
     
    2. Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism
    H Yamamoto, K Takio, M Sugahara - Section D: Biological , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch