.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kyh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Bacillus subtilis YXKO--a member of the UPF0031 family and a putative kinase. J.Struct.Biol. 139 161-170 2002
    Site MCSG
    PDB Id 1kyh Target Id APC234
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4464,P94368, 1423 Molecular Weight 29868.62 Da.
    Residues 276 Isoelectric Point 5.58
    Sequence mnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklvigtsenvipl ivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvltadcpvildagalakrtyp kregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqtvivlkgnqtviafpdgdcwlnptgng alakggtgdtltgmilgmlcchedpkhavlnavylhgacaelwtdehsahtllahelsdilprvwkrfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.232
    Matthews' coefficent 2.98 Rfactor 0.228
    Waters 209 Solvent Content 58.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kyh
    1. Novel Sm-like proteins with long C-terminal tails and associated methyltransferases
    M Albrecht, T Lengauer - FEBS letters, 2004 - Elsevier
     
    2. 3D-QSAR study for DNA cleavage proteins with a potential anti-tumor ATCUN-like motif
    H Gonzlez-Daz, Snchez-Gonzlez - Journal of inorganic , 2006 - Elsevier
     
    3. Crystal Structure of an Aminoimidazole Riboside Kinase from Salmonella enterica: Implications for the Evolution of the Ribokinase Superfamily
    Y Zhang, M Dougherty, DM Downs, SE Ealick - Structure, 2004 - Elsevier
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. Crystal structure of the PdxY protein from Escherichia coli
    MK Safo, FN Musayev, S Hunt, ML Di Salvo - Journal of , 2004 - Am Soc Microbiol
     
    6. Structure of Bacillus subtilis YXKO--a member of the UPF0031 family and a putative kinase
    RG Zhang, J Grembecka, E Vinokour, F Collart - Journal of structural , 2002 - Elsevier
     
    7. Combining fold recognition and exploratory data analysis for searching for glycosyltransferases in the genome of Mycobacterium tuberculosis
    M Wimmerov, SB Engelsen, E Bettler, C Breton - Biochimie, 2003 - Elsevier
     
    8. Functional analysis of the glycero-manno-heptose 7-phosphate kinase domain from the bifunctional HldE protein, which is involved in ADP-l-glycero-d-manno-
    F McArthur, CE Andersson, S Loutet - Journal of , 2005 - Am Soc Microbiol
     
    9. ATCUN_like metal_binding motifs in proteins: Identification and characterization by crystal structure and sequence analysis
    R Sankararamakrishnan, S Verma - Structure, Function, and , 2005 - Wiley Online Library
     
    10. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: application
    FJ Stevens, C Kuemmel, G Babnigg - Journal of Molecular , 2005 - Wiley Online Library
     
    11. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    12. Preliminary X-ray crystallographic analysis of SMU. 573, a putative sugar kinase from Streptococcus mutans
    YF Zhou, LF Li, C Yang, YH Liang - Crystallographica Section F , 2007 - scripts.iucr.org
     
    13. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    14. Identification of Unknown Protein Function Using Metabolite Cocktail Screening
    IA Shumilin, M Cymborowski, O Chertihin, KN Jha - Structure, 2012 - Elsevier
     

    Protein Summary

    Contains a Pfam carbohydrate kinase (Carb_kinase) domain

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch