.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kxj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of glutamine amidotransferase from Thermotoga maritima. Proteins 49 420-422 2002
    Site MCSG
    PDB Id 1kxj Target Id APC037
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4417,AAD36115, 2336 Molecular Weight 23095.37 Da.
    Residues 201 Isoelectric Point 6.33
    Sequence mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrrlrendlidf vrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlphmgwnevifkdtfpngyyy fvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpeksskigrkllekviecslsrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.274
    Matthews' coefficent 3.65 Rfactor 0.229
    Waters Solvent Content 66.30

    Pathway

    Reactions found in Metabolic Reconstruction for TM1038TM0063

    Name: Imidazole-glycerol-3-phosphate synthase
    Other genes that carryout this rxn:TM1036
    Metabolic Subsystem: Histidine Biosynthesis
    Reaction: : gln-L + prlp --> aicar + eig3p + glu-L + h

     

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch