| Title | Structure of Escherichia coli ribose-5-phosphate isomerase: a ubiquitous enzyme of the pentose phosphate pathway and the Calvin cycle. STRUCTURE 11 31-42 2003 | | Site | MCSG | | PDB Id | | Target Id | APC065 | | Related PDB Ids 1o8b | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4434,AAC75951, 562 | Molecular Weight | 22859.15 Da. | | Residues | 219 | Isoelectric Point | 5.20 | | Sequence | mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgihvfd lnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadaskqvdilgkfplpvevipm arsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenainaipgvvtvglfanrgadval igtpdgvktivk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.50 | Rfree | 0.237 | | Matthews' coefficent | 2.21 | Rfactor | 0.224 | | Waters | 660 | Solvent Content | 44.28 |
| Ligand Information | | Ligands | | | Metals | | | |
