.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution. Proteins 54 162-165 2004
    Site MCSG
    PDB Id 1kr4 Target Id APC012
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4413,AAD36133, 2336 Molecular Weight 12176.50 Da.
    Residues 101 Isoelectric Point 5.30
    Sequence milvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktteekekelyeel rklhpyetpaiftlkvenvlteymnwlresvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.241
    Matthews' coefficent Rfactor 0.218
    Waters 125 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch