| Title | Crystal structure of MT0777. To be published | | Site | MCSG | | PDB Id | | Target Id | APC078 | | Molecular Characteristics | | Source | Methanobacterium thermoautotrophicum | | Alias Ids | TPS4441,H69203, 145262 | Molecular Weight | 17273.85 Da. | | Residues | 157 | Isoelectric Point | 4.58 | | Sequence | mktestgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiytdemvdles cinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvleelvneimetldaeiiaara hhnpaplrvridrfmeekp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.25 | | Matthews' coefficent | 2.32 | Rfactor | 0.217 | | Waters | 173 | Solvent Content | 46.93 |
| Ligand Information | | Ligands | | | Metals | | | |
