.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k7k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Molecular basis of the antimutagenic activity of the house-cleaning inosine triphosphate pyrophosphatase RdgB from Escherichia coli. J.Mol.Biol. 374 1091-1103 2007
    Site MCSG
    PDB Id 1k7k Target Id APC074
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4438,AAC75991, 562 Molecular Weight 21037.65 Da.
    Residues 197 Isoelectric Point 5.21
    Sequence mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakvtalpaiadd sglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhcvlvylrhaedptplvchg swpgvitrepagtggfgydpiffvpsegktaaeltreeksaishrgqalkllldalrng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2375100
    Matthews' coefficent 2.57 Rfactor 0.2113500
    Waters 255 Solvent Content 52.18

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch