| Title | Molecular basis of the antimutagenic activity of the house-cleaning inosine triphosphate pyrophosphatase RdgB from Escherichia coli. J.Mol.Biol. 374 1091-1103 2007 | | Site | MCSG | | PDB Id | | Target Id | APC074 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4438,AAC75991, 562 | Molecular Weight | 21037.65 Da. | | Residues | 197 | Isoelectric Point | 5.21 | | Sequence | mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakvtalpaiadd sglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhcvlvylrhaedptplvchg swpgvitrepagtggfgydpiffvpsegktaaeltreeksaishrgqalkllldalrng | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.50 | Rfree | 0.2375100 | | Matthews' coefficent | 2.57 | Rfactor | 0.2113500 | | Waters | 255 | Solvent Content | 52.18 |
| Ligand Information | | Ligands | | | Metals | | | |
