.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k7j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Genomics, protein TF1. To be Published
    Site MCSG
    PDB Id 1k7j Target Id APC115
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4449,P45847, 562 Molecular Weight 23210.55 Da.
    Residues 206 Isoelectric Point 5.97
    Sequence msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlpdghnftlmc rdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktigmrvpsnpiaqallealge pmlstslmlpgseftesdpeeikdrlekqvdliihggylgqkpttvidltddtpvvvregvgdvkpfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.2030000
    Matthews' coefficent 2.62 Rfactor 0.1950000
    Waters 235 Solvent Content 53.07

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1k7j
    1. Structural analysis and functional implications of the negative mTORC1 regulator REDD1
    S Vega-Rubin-de-Celis, Z Abdallah, L Kinch - Biochemistry, 2010 - ACS Publications
     
    2. Prediction of side_chain conformations on protein surfaces
    Z Xiang, PJ Steinbach, MP Jacobson - PROTEINS: , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch