.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k77

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Escherichia coli EC1530, a glyoxylate induced protein YgbM. Proteins 48 427-430 2002
    Site MCSG
    PDB Id 1k77 Target Id APC066
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4435,AAC75781, 562 Molecular Weight 29215.44 Da.
    Residues 258 Isoelectric Point 5.09
    Sequence mprfaanlsmmftevpfierfaaarkagfdaveflfpynystlqiqkqleqnhltlalfntapgdinag ewglsalpgreheahadidlaleyalalnceqvhvmagvvpagedaeryravfidniryaadrfaphgk rilvealspgvkphylfssqyqalaiveevardnvfiqldtfhaqkvdgnlthlirdyagkyahvqiag lpdrhepddgeinypwlfrlfdevgyqgwigceykprglteeglgwfdawr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.2140000
    Matthews' coefficent 2.56 Rfactor 0.1940000
    Waters 272 Solvent Content 52.04

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;FMT (FORMIC) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1k77
    1. Comparative modeling in CASP6 using consensus approach to template selection, sequence_structure alignment, and structure assessment
    _ Venclovas, M Margelevi_ius - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    2. PDB
    M Von Grotthuss, D Plewczynski, K Ginalski - BMC , 2006 - biomedcentral.com
     
    3. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    4. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    5. Crystal Structure of SCO6571 from Streptomyces coelicolor A3 (2)
    P Begum, N Sakai, T Hayashi, YG Gao - Protein and peptide , 2008 - ingentaconnect.com
     
    6. Crystal structure of Escherichia coli EC1530, a glyoxylate induced protein YgbM
    Y Kim, T Skarina, S Beasley - Proteins: Structure, , 2002 - Wiley Online Library
     
    7. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch