| Title | Conserved protein YecM from Escherichia coli shows structural homology to metal-binding isomerases and oxygenases. Proteins 51 311-314 2003 | | Site | MCSG | | PDB Id | | Target Id | APC070 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4436,NP_754182, 562 | Molecular Weight | 21465.19 Da. | | Residues | 190 | Isoelectric Point | 5.22 | | Sequence | mimanwqsidelqdiasdlprfthaldelsrrlglditpltadhislrchqnvtaerwrrgfeqcgell senmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehieivlpgdpetlnaralallsde glslpgisvktsspkgeherlpnptlavtdgkttikfhpwsieeivaseqsa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.217 | | Matthews' coefficent | 1.96 | Rfactor | 0.199 | | Waters | 253 | Solvent Content | 37.18 |
| Ligand Information | | Ligands | | | Metals | | | |
