.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k3r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Deep trefoil knot implicated in RNA binding found in an archaebacterial protein. Proteins 50 177-183 2003
    Site MCSG
    PDB Id 1k3r Target Id APC131
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS4457,NP_275146, 145262 Molecular Weight 30189.36 Da.
    Residues 268 Isoelectric Point 8.42
    Sequence mnrvdlsifipdsltaetgdlkiktykvvliaraasifgvkriviyhddadgearfirdiltymdtpqy lrrkvfpimrelkhvgilpplrtphhptgkpvtgeyrqgltvkrvkkgtlvdigadklalcrekltvnr imsfrvvrlgkeiliepdepedrywgyevldtrrnlaeslktvgadvvvatsrnaspitsildevktrm rgareaailfggpykglpeidadiwvntlpgqctetvrteeavlatlsvfnmltqidekde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2773
    Matthews' coefficent 2.34 Rfactor 0.2214
    Waters 120 Solvent Content 47.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1k3r
    1. Systems level insights into the stress response to UV radiation in the halophilic archaeon Halobacterium NRC-1
    NS Baliga, SJ Bjork, R Bonneau, M Pan - Genome , 2004 - genome.cshlp.org
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. Crystal structure of tRNA (m1G37) methyltransferase: insights into tRNA recognition
    HJ Ahn, HW Kim, HJ Yoon, BII Lee, SW Suh - The EMBO journal, 2003 - nature.com
     
    4. Structure of the YibK methyltransferase from Haemophilus influenzae (HI0766): a cofactor bound at a site formed by a knot
    K Lim, H Zhang, A Tempczyk - Proteins: Structure, , 2003 - Wiley Online Library
     
    5. Protein knots and fold complexity: Some new twists
    WR Taylor - Computational biology and chemistry, 2007 - Elsevier
     
    6. Deep trefoil knot implicated in RNA binding found in an archaebacterial protein
    TI Zarembinski, Y Kim, K Peterson - Proteins: Structure, , 2003 - Wiley Online Library
     
    7. Structure and Function of the Antibiotic Resistance-mediating Methyltransferase AviRb from Streptomyces viridochromogenes
    TG Mosbacher, A Bechthold, GE Schulz - Journal of molecular biology, 2005 - Elsevier
     
    8. Database searching by flexible protein structure alignment
    Y Ye, A Godzik - Protein science, 2004 - Wiley Online Library
     
    9. Functional assignment based on structural analysis: crystal structure of the yggJ protein (HI0303) of Haemophilus influenzae reveals an RNA methyltransferase with a
    F Forouhar, J Shen, R Xiao, TB Acton - Proteins: Structure, , 2003 - Wiley Online Library
     
    10. Rapid knot detection and application to protein structure prediction
    F Khatib, MT Weirauch, CA Rohl - Bioinformatics, 2006 - Oxford Univ Press
     
    11. Crystal structure of tRNA (m1G37) methyltransferase from Aquifex aeolicus at 2.6 resolution: a novel methyltransferase fold
    J Liu, W Wang, DH Shin, H Yokota - Proteins: Structure, , 2003 - Wiley Online Library
     
    12. Post-translational Modification of Ribosomal Proteins
    S Arragain, R Garcia-Serres, G Blondin, T Douki - Journal of Biological , 2010 - ASBMB
     
    13. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    14. Characterization of the cofactor-binding site in the SPOUT-fold methyltransferases by computational docking of S-adenosylmethionine to three crystal
    M Kurowski, J Sasin, M Feder, J Debski - BMC , 2003 - biomedcentral.com
     
    15. Are aromatic carbon donor hydrogen bonds linear in proteins?
    V Nanda, A Schmiedekamp - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    16. Fold-recognition and comparative modeling of human _2, 3-sialyltransferases reveal their sequence and structural similarities to CstII from Campylobacter
    MS Sujatha, P Balaji - BMC structural biology, 2006 - biomedcentral.com
     
    17. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     
    18. Structural statistical properties of knotted proteins
    W Xiang-Hong, S Yu, Z Lin-Xi - Chinese Physics B, 2009 - iopscience.iop.org
     
    19. 1 Protein methyltransferases: Their distribution among the five structural classes of adomet-dependent methyltransferases
    HL Schubert, RM Blumenthal, X Cheng - The Enzymes, 2006 - Elsevier
     
    20. Spectral markers for knotted core of proteins
    P Lissy Anto, AS Nair - CIB'2009, 2009 - cls.zju.edu.cn
     
    21. The Conformational Relationship between Knotted Proteins and Corresponding mRNA Templates
    RH Hung - 2007 - etdncku.lib.ncku.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch