TOPSAN > Proteins > MCSG > 1ji0

1ji0

Page last modified 00:29, 25 Sep 2010 by Admin

Email link

Page Notifications Off

Summary Discussions

Table of contents

1. Protein Summary
2. Ligand Summary

Molecular Characteristics
Title	The 2.0 A Crystal Structure of ABC Transporter from Thermotoga maritima. TO BE PUBLISHED
Site	MCSG
PDB Id	1ji0	Target Id	APC046
Source	Thermotoga maritima
Alias Ids	TPS4423,AAD36215, 2336	Molecular Weight	26189.41 Da.
Residues	239	Isoelectric Point	9.17
Sequence	msdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqkgkiifngqdi tnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdlewifslfprlkerlkqlggt lsggeqqmlaigralmsrpkllmmdepslglapilvsevfeviqkinqegttillveqnalgalkvahy gyvletgqivlegkaselldnemvrkaylgva
	BLAST FFAS

Structure Determination
Method	XRAY	Chains	1
Resolution (Å)	2.00	Rfree	0.2640000
Matthews' coefficent	2.47	Rfactor	0.2420000
Waters	197	Solvent Content	50.20

Pathway
Reactions found in Metabolic Reconstruction for TM1139
Name: L-threonine transport via ABC system Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136 Metabolic Subsystem: Transport Reaction: atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 + thr-L[e] Name:L-Threonine Formula:C4H9NO3 KEGG: C00188 --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + h[c] Name:H+ Formula:H KEGG: C00080 + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009 + thr-L[c] Name:L-Threonine Formula:C4H9NO3 KEGG: C00188
Name: L-valine transport via ABC system Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136 Metabolic Subsystem: Transport Reaction: atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 + val-L[e] Name:L-Valine Formula:C5H11NO2 KEGG: C00183 --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + h[c] Name:H+ Formula:H KEGG: C00080 + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009 + val-L[c] Name:L-Valine Formula:C5H11NO2 KEGG: C00183
Name: L-alanine transport via ABC system Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136 Metabolic Subsystem: Transport Reaction: ala-L[e] Name:L-Alanine Formula:C3H7NO2 KEGG: C00041 + atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + ala-L[c] Name:L-Alanine Formula:C3H7NO2 KEGG: C00041 + h[c] Name:H+ Formula:H KEGG: C00080 + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009
Name: L-leucine transport via ABC system Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136 Metabolic Subsystem: Transport Reaction: atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 + leu-L[e] Name:L-Leucine Formula:C6H13NO2 KEGG: C00123 --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + h[c] Name:H+ Formula:H KEGG: C00080 + leu-L[c] Name:L-Leucine Formula:C6H13NO2 KEGG: C00123 + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009
Name: L-isoleucine transport via ABC system Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136 Metabolic Subsystem: Transport Reaction: atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 + ile-L[e] Name:L-Isoleucine Formula:C6H13NO2 KEGG: C00407 --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + h[c] Name:H+ Formula:H KEGG: C00080 + ile-L[c] Name:L-Isoleucine Formula:C6H13NO2 KEGG: C00407 + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009

Ligand Information
Ligands	ATP (ADENOSINE-5'-TRIPHOSPHATE) x 1
Metals

1ji0

Resources
- PDB
- PDBSum
- PSI-KB
- PlasmID
- Proteopedia
- GPSS
- ProFunc

Protein Summary

Ligand Summary

Reviews References Images Files Tags

Reviews

References

No references found.

Add tag

Tag page

MCSG

What links here

Attach file or image

Files (0)

Attach file or image

Images (0)

Images 0
No images to display in the gallery.

You must login to post a comment.

All content on this site is licensed under a Creative Commons Attribution 3.0 License

Powered by MindTouch