.
The Open Protein Structure Annotation Network
PDB Keyword
.

1i6n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding. Proteins 48 423-426 2002
    Site MCSG
    PDB Id 1i6n Target Id APC236
    Related PDB Ids 1i60 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4466,P42419, 1423 Molecular Weight 31654.38 Da.
    Residues 278 Isoelectric Point 4.85
    Sequence mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhikplalnalv ffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikkssvdvltelsdiaepygvk ialefvghpqctvntfeqayeivntvnrdnvglvldsfhfhamgsnieslkqadgkkifiyhiddtedf pigfltdedrvwpgqgaidldahlsalkeigfsdvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.238
    Matthews' coefficent 2.93 Rfactor 0.201
    Waters 174 Solvent Content 58.08

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1i6n
    1. GH97 is a new family of glycoside hydrolases, which is related to the _-galactosidase superfamily
    D Naumoff - BMC genomics, 2005 - biomedcentral.com
     
    2. Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding
    RG Zhang, I Dementieva, N Duke - Proteins: Structure, , 2002 - Wiley Online Library
     
    3. Cocatalytic zinc sites
    DS Auld - Encyclopedia of Inorganic and Bioinorganic , 2004 - Wiley Online Library
     
    4. Metal-binding sites are designed to achieve optimal mechanical and signaling properties
    A Dutta, I Bahar - Structure, 2010 - Elsevier
     
    5. Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate
    R Shi, M Pineda, E Ajamian, Q Cui, A Matte - Journal of , 2008 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1i60.png
    No description
    35.42 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch