.
The Open Protein Structure Annotation Network
PDB Keyword
.

1exc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional implications from crystal structures of the conserved Bacillus subtilis protein Maf with and without dUTP. Proc.Natl.Acad.Sci.USA 97 6328-6333 2000
    Site MCSG
    PDB Id 1exc Target Id APC121
    Related PDB Ids 1ex2 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4453,Q02169, 1423 Molecular Weight 21294.24 Da.
    Residues 189 Isoelectric Point 5.77
    Sequence mtkplilasqsprrkelldllqlpysiivseveeklnrnfspeenvqwlakqkakavadlhphaiviga dtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydktevafwslseeeiwtyi etkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralrhfdira
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.26
    Matthews' coefficent 2.95 Rfactor 0.197
    Waters 140 Solvent Content 58.35

    Ligand Information
    Ligands DUT (DEOXYURIDINE-5'-TRIPHOSPHATE) x 4
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1exc
    1. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    2. Functional implications from crystal structures of the conserved Bacillus subtilis protein Maf with and without dUTP
    G Minasov, M Teplova, GC Stewart - Proceedings of the , 2000 - National Acad Sciences
     
    3. Identification of an ITPase/XTPase in Escherichia coli by structural and biochemical analysis
    J Zheng, VK Singh, Z Jia - Structure, 2005 - Elsevier
     
    4. Stochastic algorithm for kinase homology model construction
    A Rayan, E Noy, D Chema, A Levitzki - Current medicinal , 2004 - ingentaconnect.com
     
    5. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    6. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    7. The sequence TGAAKAVALVL from glyceraldehyde_3_phosphate dehydrogenase displays structural ambivalence and interconverts between __helical and __hairpin
    S Patel, PV Balaji, YU Sasidhar - Journal of Peptide Science, 2007 - Wiley Online Library
     
    8. Protein ontology instance store
    A Sidhu, T Dillon, E Chang - On the Move to Meaningful Internet Systems , 2007 - Springer
     
    9. GENERATION OF A DATASET FOR STUDYING LIGAND EFFECT ON HOMODIMER INTERFACE
    L Li, JGK Gan, Z Cui, MK Sakharkar - Frontiers in , 2005 - bioscience.org
     
    10. Thermal Effect on Aequorea Green Fluorescent Protein Anionic and Neutral Chromophore Forms Fluorescence
    AM dos Santos - Journal of fluorescence, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1ex2.png
    No description
    20.73 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch