.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ex2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional implications from crystal structures of the conserved Bacillus subtilis protein Maf with and without dUTP. Proc.Natl.Acad.Sci.USA 97 6328-6333 2000
    Site MCSG
    PDB Id 1ex2 Target Id APC121
    Related PDB Ids 1exc 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4452,Q02169, 1423 Molecular Weight 21294.24 Da.
    Residues 189 Isoelectric Point 5.77
    Sequence mtkplilasqsprrkelldllqlpysiivseveeklnrnfspeenvqwlakqkakavadlhphaiviga dtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydktevafwslseeeiwtyi etkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralrhfdira
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.223
    Matthews' coefficent 2.97 Rfactor 0.195
    Waters 306 Solvent Content 58.54

    Ligand Information
    Ligands SUC (SUCROSE) x 1;PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1ex2
    1. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    2. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    3. Structural genomics of highly conserved microbial genes of unknown function in search of new antibacterial targets
    C Abergel, B Coutard, D Byrne, S Chenivesse - Journal of structural and , 2003 - Springer
     
    4. Functional implications from crystal structures of the conserved Bacillus subtilis protein Maf with and without dUTP
    G Minasov, M Teplova, GC Stewart - Proceedings of the , 2000 - National Acad Sciences
     
    5. Identification of an ITPase/XTPase in Escherichia coli by structural and biochemical analysis
    J Zheng, VK Singh, Z Jia - Structure, 2005 - Elsevier
     
    6. Piecing together the structurefunction puzzle: Experiences in structure_based functional annotation of hypothetical proteins
    MA Adams, MDL Suits, J Zheng, Z Jia - Proteomics, 2007 - Wiley Online Library
     
    7. Protein docking using surface matching and supervised machine learning
    AJ Bordner, AA Gorin - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    8. Crystal structure of VC0702 at 2.0 : conserved hypothetical protein from Vibrio cholerae
    S Ni, F Forouhar, DE Bussiere - Proteins: Structure, , 2006 - Wiley Online Library
     
    9. Using correlated parameters for improved ranking of proteinprotein docking decoys
    P Mitra, D Pal - Journal of computational chemistry, 2011 - Wiley Online Library
     
    10. Patch prediction of protein interaction sites: validation of a scoring function for an online server
    S Jones, Y Mukarami - Bioinformatics Research and Development, 2007 - Springer
     
    11. GENERATION OF A DATASET FOR STUDYING LIGAND EFFECT ON HOMODIMER INTERFACE
    L Li, JGK Gan, Z Cui, MK Sakharkar - Frontiers in , 2005 - bioscience.org
     
    12. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    13. Reprsentation simplifie des protines
    A Annexe - theses.ulb.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch