.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dwk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Cyanase Reveals that a Novel Dimeric and Decameric Arrangement of Subunits is Required for Formation of the Enzyme Active Site. Structure 8 505 2000
    Site MCSG
    PDB Id 1dwk Target Id APC127
    Related PDB Ids 1dw9 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4455,P00816, 562 Molecular Weight 17047.82 Da.
    Residues 156 Isoelectric Point 5.00
    Sequence miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarlvgakldlde dsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeg geravitldgkylptkpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 1.65 Rfree 0.181
    Matthews' coefficent 2.53 Rfactor 0.146
    Waters 2464 Solvent Content 51

    Ligand Information
    Ligands SO4 (SULFATE) x 23;OXL (OXALATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1dwk
    1. An accurate, sensitive, and scalable method to identify functional sites in protein structures
    H Yao, DM Kristensen, I Mihalek, ME Sowa - Journal of molecular , 2003 - Elsevier
     
    2. Structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site
    MA Walsh, Z Otwinowski, A Perrakis, PM Anderson - Structure, 2000 - Elsevier
     
    3. Stochastic algorithm for kinase homology model construction
    A Rayan, E Noy, D Chema, A Levitzki - Current medicinal , 2004 - ingentaconnect.com
     
    4. Sparcl: Efficient and effective shape-based clustering
    V Chaoji, M Al Hasan, S Salem - Data Mining, 2008. ICDM' , 2008 - ieeexplore.ieee.org
     
    5. Combining image-seeking functions and a subtraction strategy: a vector-space procedure to improve many-body searches in molecular replacement
    C Alvarez-Rua, J Borge, S Garcia-Granda - Acta Crystallographica Section , 2002 - iucr.org
     
    6. Reprsentation simplifie des protines
    A Annexe - theses.ulb.ac.be
     
    7. Analysis of transmembrane and globular protein depending on their solvent energy
    S Wakadkar - his.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1dw9.png
    No description
    59.86 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch