.
The Open Protein Structure Annotation Network
PDB Keyword
.
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a centrosomal protein 170kDa, transcript variant beta (CEP170) from Homo sapiens at 2.15 A resolution (PSI Community Target, Sundstrom). To be published
    Site JCSG
    PDB Id 4jon Target Id 424890
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS74972,NM_001042404 Molecular Weight 14476.72 Da.
    Residues 126 Isoelectric Point 5.77
    Sequence msltswflvssggtrhrlpremifvgrddcelmlqsrsvdkqhavinydastdehlvkdlgslngtfvn dvripeqtyitlkledklrfgydtnlftvvqgemrvpeealkhekftiqlqlsqkss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.15 Rfree 0.2029
    Matthews' coefficent 2.91 Rfactor 0.1826
    Waters 296 Solvent Content 57.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This corresponds to the n-terminal FHA domain of the CEP170 protein, which is part of centrosome. The structure indicates that  CEP170-FHA lacks the canonical pThr recognition site, thus unlikely to involved in signaling by binding pThr containing peptide. Instead, it may play a role in protein-protein recognition.

     

    The CEP-FHA domain forms a helical filament in the unit cell, but its biological relevance is not clear. We can not rule out that it could be an artifact of crystal packing, that may or may not have physiological relevance.

     

    Fig. 1 the asu contains 5 mols that form into a helical filament, that extends throughout the space via symm ops

    cms20865a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     cms20865a.png
    C.MS20865A-CEP170
    223.57 kB17:16, 6 Mar 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch