.
The Open Protein Structure Annotation Network
PDB Keyword
.
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4iej Target Id 423958
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS74685,BC008053 Molecular Weight 11138.95 Da.
    Residues 92 Isoelectric Point 7.15
    Sequence gkdypfarfnktvqvpvyseqeyqlylhddawtkaetdhlfdlsrrfdlrfvvihdrydhqqfkkrsve dlkeryyhicaklanvravpgtd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.2259
    Matthews' coefficent 2.06 Rfactor 0.1970
    Waters 77 Solvent Content 40.42

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    4iej.png
    No description
    863.89 kB00:13, 14 Dec 2012wchwangActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch