.
The Open Protein Structure Annotation Network
PDB Keyword
.
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of a putative L-allo-threonine aldolase (lmo0305) from Listeria monocytogenes EGD-E at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3pj0 Target Id 403100
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS30772,NP_463836.1 Molecular Weight 39896.18 Da.
    Residues 358 Isoelectric Point 4.89
    Sequence mtntlktsyqktpyklggngprnvgvltealqniddnlesdiygngaviedfetkiakilgkqsavffp sgtmaqqialriwadrkenrrvayhplshleiheqdglkelqqitplllgtanqlltiddikslrepvs svlielpqreiggqlpafeelekiseycheqgislhldgarlweitpfyqksaeeicalfdsvyvsfyk giggiagailagnddfvqeakiwkrryggdlislypyilsadyyfekrigkmaeyfeaakglaerfnsc sgvktvpevpvsnmfhvyfensadeigailtkiqdetgvgisgylqeksadvcafevsvgdafaeipak nlelvfrclekel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.198
    Matthews' coefficent 2.38 Rfactor 0.162
    Waters 1532 Solvent Content 48.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Target ID 403100 belongs to the the beta-eliminating lyase Pfam family (PF01212). This Pfam family is represented by 50 structures in the PDB. Shown below is a ribbons representation of the structure with the N-terminal end in blue and the C-terminal end in red. The structure shows the a pyridoxal-5-phosphate cofactor is covalently bound to the protein through an aldimine bond (Schiff base) at Lys 207.

    monomer.png

     

     The crystal structure suggests that a dimer is a likely oligomeric form. Shown below is a ribbons representation of the dimer with one monomer in blue and the other monomer in yellow.

    dimer.png

     The table below lists some of the top-scoring results from a DALI search of structures similar to Target ID 403100

     

    PDB ID
    DALI Z-Score
    rmsd (Angstroms)
    length of alignment
    number residues in target
    % sequence identity
    description
    3lws 54 0.9 354 354 59  Putative aromatic amino acid beta-eliminating lyase/theronine aldolas (YP_001813866.1) from Exigobacterium sp 155-15 at 2.00 Ang resolution.
    1jg8 34 3.0 329 344 20  Low-specificity Theronine Aldolase, a Key Enzyme in Glycine Biosynthesis
    1svv 29.8 3.0 322 342 18  Initial Structural Analysis of Leismania major Theronine Aldolase.
    1v72 29.5 3.0 324 345 17  Phenylserine Aldolase from Pseudomonas Putida
    1c7g 25.7 3.7 328 456 11  Tyrosine Phenol-Lyase from Erwinia Herbicola.
    1ax4 25.2 4.0 328 465 13 Tryptophanase from Proteus vulgaris
    1dje 24.2 3.3 315 383


    13

    PLP-Bound form of 8-Amino-7-oxonanoate synthase
    3a2b 24.0 3.7 319 393 14  Serine Palmitoyltransferase from Sphingobacterium multivorum with substrate L-serine
    1tpl 24.0 3.7 316 426 12  Tyrosine phenyl lyase

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer.png
    No description
    234.27 kB02:52, 21 Jul 2010haxelrodActions
     monomer.png
    No description
    224.54 kB02:35, 21 Jul 2010haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch