| Title | Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution. To be published | | Site | JCSG | Biology Target: |
| | PDB Id | | Target Id | 422736 | | Related PDB Ids 2m52 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS67068,BC043071 | Molecular Weight | 11962.03 Da. | | Residues | 104 | Isoelectric Point | 4.60 | | Sequence | ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgkifveftsvf dcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.2069 | | Matthews' coefficent | 2.57 | Rfactor | 0.1774 | | Waters | 150 | Solvent Content | 52.21 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The structure of the C-terminal RRM domain of splicing factor U2AF U2AF , an essential splicing factor that recognizes the 3' splice site and recruits the U2 snRNP to the branch point. A classical RRM domain with a very strong sequence pattern, except it has an extra C-terminal helix which plays a role in this domain being peptide rather than RNA binding (see the original 1o0p paper [1]).
Ligand Summary
