.
The Open Protein Structure Annotation Network
PDB Keyword
.

3v4m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    PDB Id 3v4m Target Id 422736
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS67068,BC043071 Molecular Weight 11962.03 Da.
    Residues 104 Isoelectric Point 4.60
    Sequence ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgkifveftsvf dcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The structure of the C-terminal RRM domain of splicing factor U2AF U2AF , an essential splicing factor that recognizes the 3' splice site and recruits the U2 snRNP to the branch point. A classical RRM domain with a very strong sequence pattern, except it has an extra C-terminal helix which plays a role in this domain being peptide rather than RNA binding (see the original 1o0p paper [1]).

    Ligand Summary

    Reviews

    References

     

    1. Selenko P, Gregorovic G, Sprangers R, Stier G, Rhani Z, Kr瓣mer A, and Sattler M Structural basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP. Mol Cell. 2003 Apr; 11(4):965-76 PubMed HubMed pmid:12718882.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch