| Site | JCSG | Biology Target: |
| | PDB Id | | Target Id | 422736 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS67068,BC043071 | Molecular Weight | 11962.03 Da. | | Residues | 104 | Isoelectric Point | 4.60 | | Sequence | ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgkifveftsvf dcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw | | | BLAST FFAS | | Structure Determination | | Method | | Chains | | | Resolution (Å) | | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The structure of the C-terminal RRM domain of splicing factor U2AF U2AF , an essential splicing factor that recognizes the 3' splice site and recruits the U2 snRNP to the branch point. A classical RRM domain with a very strong sequence pattern, except it has an extra C-terminal helix which plays a role in this domain being peptide rather than RNA binding (see the original 1o0p paper [1]).
Ligand Summary
