| Title | Crystal structure of a RNA binding domain of Hypothetical POLYADENYLATE-BINDING PROTEIN (PABPN1) from Homo sapiens at 1.95 A resolution. To be published | | Site | JCSG | Biology Target: |
| | PDB Id | | Target Id | 422572 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS67040,BC010939 | Molecular Weight | 9774.50 Da. | | Residues | 88 | Isoelectric Point | 6.82 | | Sequence | meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldes lfrgrqikvipkrtnrpgi | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.95 | Rfree | 0.2096 | | Matthews' coefficent | 3.35 | Rfactor | 0.1629 | | Waters | 57 | Solvent Content | 63.31 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The RNA binding domain of human POLYADENYLATE-BINDING PROTEIN, PABP-2 or PABII. A classical RRM domain, covered by PFAM RRM_1 family.
Ligand Summary
