.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nqn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of a Protein with unknown function. (DR_2006) from DEINOCOCCUS RADIODURANS at 1.88 A resolution. To be published
    Site JCSG
    PDB Id 3nqn Target Id 394616
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS25820,NP_295729.1 Molecular Weight 16467.85 Da.
    Residues 157 Isoelectric Point 5.05
    Sequence milsaeqsftlrhphgqaaalafvrepaaalagvrflrgldsdgeqvwgellvtvpllgevdlpfrsei vrtpqgaelrpltltgerawvavsgqataaeggemafafqfqahlatpeaegwggaafekmvqaaagrt lervakalpeglaaglppa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.238
    Matthews' coefficent 2.40 Rfactor 0.196
    Waters 190 Solvent Content 48.76

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The structure of protein DR_2006 (target ID 394616) from Deinococcus radiodurans, one of the most radioresistant organisms known, was determined by three wavelength Se-MAD at a resolution of 1.88  Angstroms.  DR_2006 is a founding member of  a new PFAM family DUF3809 (PF12723). Members of this family are found in extremophiles from the Deinococcus-Thermus phylum. This family is distantly related to other uncharacterized PFAM families, DUF1997 (PF09366) and DUF1885 (PF08968), possibly forming a new clan. The latter relation is confirmed by a significant structural similarity to a representative from the DUF1885 family solved by MCSG (1t6a). 

     

    Shown below is a ribbons representation of the structure color-coded with the N-terminal end in blue and the C-terminal end in red.

    monomer.png

     

    The structure of target ID 394616 shows a TBP-like fold, a fold found in the TATA box-binding proteins. The structure indicates that a dimer (see below) is a biologically-significant oligomerization state. Shown below is a ribbon representation of the the dimer with the individual chains in blue and yellow respectively.

    dimer.png

     

    A DALI search shows that the structure of target ID 394616 is similar to these other structures

     

    PDB ID DALI Z-Score rmsd overlap (Angstroms) number of aligned residues total residues in target % sequence id Description
    3ggn 10.7 2.6 116 131 11 DR_A0006 from Deinococcus radiodurans. Northeaset Structural Genomics Consortium Target DrR147D
    2d4r 10.2 3.1 127 146 6  TTHA0849 from Thermus thermophilus HB8 at 2.4 Angstrom resolution: a putative member of the StAR-related lipid-transfer (START domain superfamily.
    2ns9 9.7 3.6 127 152 9 Protein APE2225 from Aeropyrim pernix,Pfam COXG
    2ejx 9.6 2.9 120 134 5

     Hypothetical protein ST0812 fromSulfolobus tokodaii

    2rez 8.7 3.3 119 155 6  Tetracenomycin ARO/CYC NaI Structure
    2e3p 8.3 3.1 131 231 4  CERT START domain in complex with C16-cearmide (P1)
    2e3r 8.3 3.1 131 226 4  CERT START domain in complex with C18-ceramide (P1)
    2res 8.3 3.4 120 152 5  Tetracenomycin ARO/CYC mutant R69A
    1jss 8.2 3.9 132 199 9  Mus musculus cholesterol-regulated START protein 4 (StarD4).


     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch