| Title | Crystal structure of SusD superfamily protein (BT_2365) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.49 A resolution. To be Published | | Site | JCSG | | PDB Id | | Target Id | 396190 | | Molecular Characteristics | | Source | Bacteroides thetaiotaomicron vpi-5482 | | Alias Ids | TPS25867,NP_811278.1 | Molecular Weight | 53255.51 Da. | | Residues | 476 | Isoelectric Point | 4.91 | | Sequence | dwldlnttssvetgqaivtlddaqialngiyrlasghsyygdnywyygdcraadvqaritkgdgkrvsp yyeynvlasdnlnivlpwntvykvirqtnnliqkiesgsiqssdtkelnriksealvmrglslfnltrl fgmpytndkgaslgvpietspsdpthkpsrstvaqcyeqvvsdmsnalsglrqetsngyinywaaqall srvylnmgeyqkaydaatdviknnggryqlysyeeypnvwgqdfqseslfelyitlsepsggtggegap mvyaneatvdwnnlilsedflnllnedpkdvrhcltkesvienntglpaaamhekvylakfpgktgddp ktnniciirlsevylnaaeaglkkgtdieeaqgylndiisrrttdtsqqvstetftldrilkerrkelv gegevfydylrnglaierkgswhletlkasnaqkieatdlrialpipqseidanpniqqnpr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.49 | Rfree | 0.161 | | Matthews' coefficent | 2.70 | Rfactor | 0.142 | | Waters | 770 | Solvent Content | 54.51 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
BT_2365 (NP_811278) from Bacteroides thetaiotaomicron vpi-5482 is a SusD homolog matching Pfam PF07980.
JCSG has solved structures of numerous SusD protein like 3mcx; for example PDB ids 3kez (~37% seq id) and 3jq1, 3lew, 3ihv and 3l22 (all with ~22-26% sed id); and 3iv0, 3hdx, 3jq0, 3jys, 3fdh, 3ejn, 3cgh, 3gzs.
Expression data from Jeff Gordon lab, shows that BT_2365 is strongly upregulated in the early phase (3-6h) of rich polysaccharide (in contrast to minimal media + glucose or maltose) diet both in vitro and in vivo (mouse cecum)
Ligand Summary
