.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mc3

    Title Crystal structure of DsrE/DsrF-like family protein (NP_342589.1) from SULFOLOBUS SOLFATARICUS at 1.49 A resolution. To be published
    Site JCSG
    PDB Id 3mc3 Target Id 381769
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS7330,NP_342589.1, BIG_508, 87186 Molecular Weight 15199.79 Da.
    Residues 133 Isoelectric Point 4.97
    Sequence maqaqtqgqeeeqkkkilivvthgpedldrtyaplfmasisasmeyetsvffmikgpklldkkwqeeer kkggnpfihffdmakengvkmyvcvqslkdmchmkeddvvegielvggstlidltleadrtlff
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.49 Rfree 0.140
    Matthews' coefficent 2.61 Rfactor 0.122
    Waters 116 Solvent Content 52.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mc3
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The protein NP_342589.1 is annotated as Conserved hypothetical protein. NP_342589.1 belongs to PFAM PF02635 DrsE which contains a small soluble protein involved in intracellular sulfur reduction. This family also includes DsrF.

     The monomer structure is shown below.

    PU12822A.png

    The protein most likely assembles as a trimer, as shown below.

    PU12822A_trimer.png

     

     There are a few structural homologs of this protein, as shown by SSM search below.

    SSM Structural Homologs
    N PDB Q-score RMSD Description (JCSG structures highlighted in red)
    1 1jx7 0.6071 1.855 YCHN PROTEIN FROM E.COLI
    2 2hy5 0.5962 1.692 DSREFH
    3 2hyb 0.591 1.722 HEXAMERIC DSREFH
    4 1l1s 0.584 1.973 STRUCTURE OF PROTEIN OF UNKNOWN FUNCTION MTH1491 FROM METHANOBACTERIUM THERMOAUTOTROPHICUM
    5 2d1p 0.5694 1.855 HETEROHEXAMERIC TUSBCD PROTEINS, WHICH ARE CRUCIAL FOR THE TRNA MODIFICATION
    6 2pd2 0.56 1.948 (ST0148) CONSERVED HYPOTHETICAL FROM SULFOLOBUS TOKODAII STRAIN7
    7 2qs7 0.5408 1.483 PROTEIN OF UNKNOWN FUNCTION (NP_342590.1) FROM SULFOLOBUS SOLFATARICUS AT 2.09 A RESOLUTION

     

     A superposition of these structures is shown below.

    PU12822A_all.png

    The color scheme is NP_342589.1 (green), 1jx7 (cyan), 1l1s (lightmagenta), 2d1p (yellow), 2hy5 (salmon), 2hyb (lightgrey), 2pd2 (slate), 2qs7 (orange).
     

     

    Literature references
    1. Pott AS, Dahl C; , Microbiology 1998;144:1881-1894.: Sirohaem sulfite reductase and other proteins encoded by genes at the dsr locus of Chromatium vinosum are involved in the oxidation of intracellular sulfur. PUBMED:9695921

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch