| Title | The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role. Acta Crystallogr.,Sect.F 66 1160-1166 2010 | | Site | JCSG | | PDB Id | | Target Id | 361217 | | Molecular Characteristics | | Source | Sulfolobus solfataricus p2 | | Alias Ids | TPS1467,13815350 | Molecular Weight | 16466.03 Da. | | Residues | 144 | Isoelectric Point | 6.60 | | Sequence | msweksgkegsllrwydvmeaeryeytvgpageqffnglkqnkiigskcskcgrifvparsycehcfvk ienyveinkdeayvdsytiiynddegnklaqpvyialirfpnieggllcyaegnvkvgakakilsfqwp lrvkvd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.200 | | Matthews' coefficent | 2.45 | Rfactor | 0.169 | | Waters | 202 | Solvent Content | 49.79 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
Gene SSO2064 from Sulfolobus solfataricus encodes the NP_343458 protein belonging to the DUF35 family (PF12172 rubredoxin, and PF01796 OB fold). STRING genome context analysis shows two 0.9 scored hits with the acetyl-Coa acetyltransferases SSO2061 and SSO2062.
3irb structure (identical to 2gnr) contains two long N-terminal helices followed by a rubredoxin-like zinc finger domain [Ref] and a C-terminal OB fold domain. The presence of the zinc finger domain was predicted previously by Koonin et al [Ref]. A Dali search provides only weak hits (Z-scr=4) with the ethanolamine utilization proteins (EutN) like 2hd3, 2z9h, and 2qw7.
Ligand Summary
Zinc ligand was confirmed by excitation scans. In the 2gnr structure
the zinc ion is coordinated by residues Cys49, Cys52, Cys63 and Cys66.
References