.
The Open Protein Structure Annotation Network
PDB Keyword
.

3irb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role. Acta Crystallogr.,Sect.F 66 1160-1166 2010
    Site JCSG
    PDB Id 3irb Target Id 361217
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1467,13815350 Molecular Weight 16466.03 Da.
    Residues 144 Isoelectric Point 6.60
    Sequence msweksgkegsllrwydvmeaeryeytvgpageqffnglkqnkiigskcskcgrifvparsycehcfvk ienyveinkdeayvdsytiiynddegnklaqpvyialirfpnieggllcyaegnvkvgakakilsfqwp lrvkvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.200
    Matthews' coefficent 2.45 Rfactor 0.169
    Waters 202 Solvent Content 49.79

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene SSO2064 from Sulfolobus solfataricus encodes the NP_343458 protein belonging to the DUF35 family (PF12172 rubredoxin, and PF01796 OB fold). STRING genome context analysis shows two 0.9 scored hits with the acetyl-Coa acetyltransferases SSO2061 and SSO2062. 

    3irb structure (identical to 2gnr) contains two long N-terminal helices followed by a rubredoxin-like zinc finger domain [Ref] and a C-terminal OB fold domain. The presence of the zinc finger domain was predicted previously by Koonin et al [Ref]. A Dali search provides only weak hits (Z-scr=4) with the ethanolamine utilization proteins (EutN)  like 2hd3, 2z9h, and 2qw7.

    Ligand Summary

    Zinc ligand was confirmed by excitation scans. In the 2gnr structure
    the zinc ion is coordinated by residues Cys49, Cys52, Cys63 and Cys66.

    References

    Reviews

    References

     

    1. Krishna SS, Majumdar I, and Grishin NV Structural classification of zinc fingers: survey and summary. Nucleic Acids Res. 2003 Jan 15; 31(2):532-50 PubMed HubMed pmid:12527760.

       


      Discuss this publication
    2. Makarova KS and Koonin EV Comparative genomics of Archaea: how much have we learned in six years, and what's next?. Genome Biol. 2003; 4(8):115 PubMed HubMed doi:10.1186/gb-2003-4-8-115 pmid:12914651.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch