.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gwq

Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Title Crystal structure of D-serine deaminase from Burkholderia xenovorans LB400 (YP_556991.1) from BURKHOLDERIA XENOVORANS LB400 at 2.00 A resolution.
Site JCSG
PDB Id 3gwq Target Id 381087
Molecular Characteristics
Source Burkholderia xenovorans lb400
Alias Ids YP_556991.1 Molecular Weight 47105.53 Da.
Residues 425 Isoelectric Point 5.44
Sequence mkvtnyqgatidpyskglgmvpgtsiqltdaarlewnllnedvslpaavlyadrvehnlkwmqafvaeyg vklaphgkttmapqlfrrqletgawgitlatahqvraayhggvsrvlmanqlvgrrnmmmvaellsdpe feffclvdsvegveqlgeffksvnkqlqvllelgvpggrtgvrdaaqrnavleaitrypdtlklagvel yegvlkeehevreflqsavavtrelveqerfarapavlsgagsawydvvaeefvkasetgkvevvlrpg cylthdvgiyrkaqtdifarnpvakkmgegllpalqlwayvqsipepdraiiglgkrdsafdagmpepa rhyrpgneaprdiaasegweifglmdqhaylripagadlkvgdmiafdishpcltfdkwrqvlvvdpay rvtevietff
  BLAST   FFAS

Structure Determination
Method XRAY Chains 2
Resolution (Å) 2.00 Rfree 0.205
Matthews' coefficent 2.46 Rfactor 0.163
Waters 472 Solvent Content 50.10

 

Ligand Information
Ligands GOL (GLYCEROL) x 4
Metals NA (SODIUM) x 1
/content/body/table/tbody/tr/td[2]/center/table/tbody/tr[2]/td/center/span, reference to undefined name 'jmol': line 1, column 1 (click for details)
/content/body/table/tbody/tr/td[2]/center/table/tbody/tr[6]/td/center/table/tbody/tr/td/span, function 'template' failed (click for details)

Protein Summary

381087 is a member of PF01168, alanine racemase N-term domain. This protein is likely a bacterial homolog of the yeast D-serine dehydratase YGL196W (see reference below).  The protein functions as a dimer. It contains a TIM fold at the middle part, the N-term is involved in dimerization, the C-term folds into a separate domain, also near the domain interface.

It is likely that this enzyme functions in D-amino acid metabolism, and binds PLP, based on gene neighborhood and the structure similarity of the middle section with 1xfc. However, the active sites differs significantly, except for Lys78 and Arg275. As a result, further analysis is needed to understand the function of this protein (eg does it really binds PLP, how?).


The closest structural matches by SSM include: 1njj, 3c5q, 2qgh. The active site in the TIM domain (near H76) bears similarity to 1njj, but is not highly conserved.

 

 

 

 

 

 

Need to try co-xtallization with PLP.

 

Figure 1 monomer

pu9913a-monomer (1).png

Figure 2 dimer

pu9913a-dimer (1).png

 

 Biochem. J. (2008) 409, 399–406 (Printed in Great Britain) doi:10.1042/BJ20070642

Ligand Summary

Reviews

References

 

No references found.

Tag page

Files (2)

FileSizeDateAttached by 
 pu9913a-dimer (1).png
PU9913 dimer
197.64 kB19:28, 11 Mar 2009qxuActions
 pu9913a-monomer (1).png
PU9913 monomer
158.61 kB19:28, 11 Mar 2009qxuActions
You must login to post a comment.

ABOUT SSL CERTIFICATES
All content on this site is licensed under a Creative Commons Attribution 3.0 License