|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Google Scholar output for 3gf8 | |
|---|---|
| 1. Expansion of the protein repertoire in newly explored environments: human gut microbiome specific protein families | |
| K Ellrott, L Jaroszewski, W Li, JC Wooley - PLoS computational , 2010 - dx.plos.org | |
| 2. Structure of a membrane-attack complex/perforin (MACPF) family protein from the human gut symbiont Bacteroides thetaiotaomicron | |
| Q Xu, P Abdubek, T Astakhova, HL Axelrod - Section F: Structural , 2010 - scripts.iucr.org | |
| 3. A conserved fold for fimbrial components revealed by the crystal structure of a putative fimbrial assembly protein (BT1062) from Bacteroides thetaiotaomicron at 2.2 A | |
| Q Xu, P Abdubek, T Astakhova, HL Axelrod - Section F: Structural , 2010 - scripts.iucr.org | |
Bacteriodes thetaiotaomicron protein BT_1062 (target db id 393038) is a two domain, all-beta secreted protein which likely functions as a monomer. The structure of BT_1062 consists of two beta sandwich domains with different, not readily alignable variants of the Greek key beta barrel topology. N-terminal domain has a prealbumin fold, found for instance in bacterial starch binding domain of beta-amylases (FATCAT alignment of an N-terminal domain of BT_1062 to the Starch-Binding Domain of Bacillus cereus B-amylase, PDB code 1cqy has an RMSD of 3.1 A with 15% sequence id). C-terminal domain has a topology similar to fibronectin III domain (FATCAT alignment to a second domain of the chain B of human interleukin 4 receptor, PDB code 1iar, has an RMSD of 3 A over 75 resiudes with a sequence id of 3.5%), but structural similarity to other sub-types of an immunoglobulin fold are also statistically significant.
Interestingly, as DUF1812 is distantly related to a family of Porphyromonas gingivalis major fimbrial subunit protein (FimA), PF06321, which are virulence factors involved in adhesion to and invasion of host (human) cells, structure and functional prediction for BT_1062 suggests a possible mechanism of function for these important virulence factors.
BT_1062 is a first representative of DUF1812 PF08842 family, large (close to 100 homologs) proteins specific to Bacteroides and present also in human gut metagenomic samples.
LipPred (cleavage residue: 25) and LipoP (sequence SpII score=7.50643 margin=3.35388 cleavage=24-25 Pos+2=D) predicts it as bacterial lipoprotein. Asp at position +2 in relation to amino-terminal Cys, indicates that this protein is probably attached to the cytoplasmic membrane at the periplasmic side.
Figure 1. monomer of 393038

Figure 2. the conserved residues are mainly located near the domain interface


39 VKFKYDYNMEFADAFHAQVDKVELYVFDKNGKYLFKQAEEGSALSTGNYLMEVELPVG-QYQFMAWAGARDSYDITSLTPGVSTLTDLKLKLKREASLII 137 2 IIKSGEGRAVGDGLADAKITKLTAMVYAGQIQ---EGIKTVEEADGVLKVEGIPCKSGANRVLVVVANHNYELTGKSLNEVEALTTSLTAENQNAKNLIM 98 138 NKRMETL-------WYGEVINVNFDGTVHQTETINLIRDTKIVRFG-FQSYTGSWTLDMNDYDYE------IIESNGHLGHDNSLLDDDVLS-------- 215 99 TGKSAAFTIKPGSNHYGYPDGTTSDNLVSAGTPLAVTRVHAGISFAGVEVNMATQYQNYYSFNPADAKIAALVAKKDSKIFGNSLVSNTNAYLYGVQTPA 198 215 ----------------------------FRPYYMEQKDPATAYVDMNTMRLMEDRKTRLVLTE-----------KASGKRVFDINLIDYLAMTNAEGKNL 276 199 GLYTPDAAGETYELEASLNTNYAVGAGFYVLESKYDASNELRPTILCIYGKLLDKDGNPLTEPALTDAINAGFCDGDGTTYYPVLVNYDGNGYIYSGAIT 298 277 STQEYLDRQSNYHIIFFLS-------------ESWLAVQIVVNGWVHRIQEE 315 299 QGQNKIVRNNHYKITLNITGPGTNTPENPQPVQANLNVTCQVTPWVVVNQAA 350
Figure. FFAS03 server detects statistically significant similarity between BT_1062 and proteins from Pfam family PF06321.2, such as UniProt: FIMA4_PORGI encoding Porphyromonas gingivalis major fimbrial subunit protein (FimA), suggesting that both families are distantly homologous and may share some similarities in their functions.
The C-terminal part of NP_809975.1 has structural similarity a wide range of proteins including PDB: 2nq3 (member of C2-domain superfamily of proteins that often bind phospholipids in a Ca2+ dependent manner; SCOP sunid:49562). The same superfamily contains FimC.
Proteins from FimA and FimC families are involved in fibre assembly through the chaperone-usher pathway [Vetsch et al. 2006, Fronzes at al 2008].
No references found.
| File | Size | Date | Attached by | |||
|---|---|---|---|---|---|---|
| consurf1.png gs13834 consurf1 | 218.52 kB | 19:33, 6 Mar 2009 | qxu | Actions | ||
| consurf2.png gs13834 consurf2 | 187.38 kB | 19:33, 6 Mar 2009 | qxu | Actions | ||
| GS13834a.png 393038 monomer | 81.02 kB | 23:40, 2 Feb 2009 | qxu | Actions | ||
| Images 3 | ||
|---|---|---|
gs13834 consurf1consurf1.png | gs13834 consurf2consurf2.png | 393038 monomerGS13834a.png |