.
The Open Protein Structure Annotation Network
PDB Keyword
.
 

3f1z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative nucleic acid-binding lipoprotein (YP_001337197.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.46 A resolution. To be published
    Site JCSG
    PDB Id 3f1z Target Id 390051
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids YP_001337197.1 Molecular Weight 14432.56 Da.
    Residues 132 Isoelectric Point 9.40
    Sequence askafysagdklfqpgddavasmqtysvaqflqpftlnpakassdylgkwvkvrgvivdirrksgiagsy yfivtmrdeqnktdkrltfnfgshnsadvealsngsvativgqvhqvqdstiptlqnpkvvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.46 Rfree 0.228
    Matthews' coefficent 3.19 Rfactor 0.192
    Waters 325 Solvent Content 61.44

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 2
    Metals

    Jmol

    Protein Summary

    Note: This structure has been accepted for publication in ActaF. Detailed structural analysis is presented in that manuscript which is in press, as of April 2010.

    Pfam update: This is a family of bacterial, archeael and viral proteins that is related to the tRNA_anti family Pfam:PF01336. The major characteristic of families like tRNA_anti is their OB-fold, and many of them bind DNA. and found, after a couple of rounds of iteration, one overlap to tRNA_anti, so went on and found more; so I have put it into the OB_-fold clan.

    This protein appears to be very novel in sequence. PSI-BLAST does not return significant hits with any other sequence. It does not have any PfamA annotation yet but a search against PfamA shows weak similarity (exp=0.71) to the family tRNA_anti PF01336 which contains proteins with the OB-fold/nucleic acid binding domain.

    FFAS also does not show any significant hits.

    The protein sequence has a predicted signal sequence which was removed during the gene construct design. The cloned construct comprises amino acids 23-145 of the full-length protein from 1-145.

    There are 10 protomers in the asymmetric unit of the crystal lattice. They form a dimer of a stacked pentameric ring:

    Fig1.pngFig2.png

    However, crystal packing analysis using the PISA server does not indicate that this decameric structure is stable in solution and the prediction for solution state is a monomer. Size exclusion chromatography coupled with static light scattering (SEC/SLS) also indicate a monomer as the oligomeric form in solution. So it is rather interesting to see this assembly in the crystal structure.

    The structure of the monomer resembles that of an OB-fold:

    Fig3_ChainA.png

     A search for proteins of similar structure using SSM at EBI shows the top hits (although Q-score is < 0.5) to the Shiga toxin protein and Human RepA (a single-stranded DNA binding protein with OB-fold). The Shiga toxin can also form a pentameric ring, but the diameter of the Shiga toxin ring is much smaller than the diameter of the pentamer that is observed here (~36 Angstroms). A search of similar structures using DALI shows some similarity to the aspartyl-tRNA synthetases anticodon domain which belongs to the PFam listed above.

    Further analysis of this structure will be made to understand possible structure-function relationships.

     

    KPN_03535 is predicted lipoprotein with SPaseII-cleaved signal peptide. This part was contributed by Piotr Kozbial.

    Prediction of lipoprotein signal peptides by LipoP-1.0 server [Juncker et al 2003, http://www.cbs.dtu.dk/services/LipoP-1.0/] supports twilight zone protein sequence similarity of KPN_03535 (GenBank: YP_001337197) to bacterial lipoproteins. The predicted cleavage site by LipoP-1.0 server (score: 17.664) is located before Cys-20 (SLLSG^CGLAS). The further analysis of this putative lipoprotein will answer the question if KPN_03535 belongs to known bacterial lipoproteins or has a completely new function.

    Homologs.

    There is only one known homolog of KPN_03535 that is annotated as predicted lipoprotein (KPK_0575, GenBank: ACI09130.1, Klebsiella pneumoniae 342). KPK_0575 is encoded next to its genomic neighbour KPK_0576 (it is also annotated as putative lipoprotein) but on the opposite strand. Detailed analysis should reveal whether KPK_0575 and KPK_0576 are expressed and what regulate their expression (to do: see if the expression of one of them is inhibiting expression of the other one)

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
     Fig1.png
    No description
    350.39 kB00:01, 18 Sep 2008debanuActions
     Fig2.png
    No description
    369.69 kB00:01, 18 Sep 2008debanuActions
     Fig3_ChainA.png
    No description
    162.92 kB00:07, 18 Sep 2008debanuActions
    You must login to post a comment.

    ABOUT SSL CERTIFICATES
    All content on this site is licensed under a Creative Commons Attribution 3.0 License