.
The Open Protein Structure Annotation Network
PDB Keyword
.
 

3e11

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of predicted zincin-like metalloprotease (YP_873820.1) from ACIDOTHERMUS CELLULOLYTICUS 11B at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3e11 Target Id 376525
    Molecular Characteristics
    Source Acidothermus cellulolyticus 11b
    Alias Ids YP_873820.1 Molecular Weight 12831.74 Da.
    Residues 113 Isoelectric Point 4.29
    Sequence mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttayggvlpdriii yrnticalcetesevidevrktvvheiahhfgidderlhelgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.204
    Matthews' coefficent 2.07 Rfactor 0.175
    Waters 193 Solvent Content 40.54

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals CA (CALCIUM) x 2

    Jmol

    Protein Summary

    Gene Acel_2062 from Acidothermus cellulolyticus 11b codes for the YP_873820.1 protein, a member of the PFAM DUF1025 family (PF06262), a large (>200 members) family of hypothetical proteins from bacteria and human, soil and ocean metagenomes. The first structure from this family (Pfam e-value 0.1) was 2ejq from Thermus thermophilus HB8. Both structures have significant stuctural similarity to metalloproteases such as MMP16 (1rn8, Z=4) and others from Peptidase MA clan. Depite the low sequence identity (~8% sequence id), the classical MMP motif (HEXXHXXGXXH) is conserved in this family except for the last histidine. At the same time distant homology prediction programs recognize this similarity, even that with a marginal statistical significance (FFAS Z-score of -8.9 as compared to -9.5 significance treshold), suggesting that DUF1025 family is distantly related to metalloproteases and should be added to the Peptidase MA clan.

    Structures of both representatives of DUF1025 family look like minimal versions of the metalloprotease fold, only three (out of 5) strands in the main beta sheet are conserved, loops are much closer and the overall length of all members of this family (~110 aa) is significantly shorter that the average MMP (~160aa)

    SCOP classifies 3e11 (2ejq and 1xm5 too) in the alpha+beta class, zincin-like fold, metalloprotease catalytic domain superfamily, TTHA0227-like family. DALI hits are with 2ejq (Z=9), and the putative metal dependent hydrolase ybeY protein 1xm5 (Z=7) from PF02130.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Picture 2.png
    FATCAT alignment betwee 3e11 and 1bqq (MT1 matrix metalloproteinase)
    495.49 kB00:10, 20 Oct 2008adamActions
    You must login to post a comment.

    ABOUT SSL CERTIFICATES
    All content on this site is licensed under a Creative Commons Attribution 3.0 License