.
The Open Protein Structure Annotation Network
.
TOPSAN > Proteins > JCSG > 3due

3due

Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Title Crystal structure of Putative Periplasmic Protein of Unknown Function (YP_001300247.1) from Bacteroides vulgatus ATCC 8482 at 1.85 A resolution. To be published
Site JCSG
PDB Id 3due Target Id 390185
Molecular Characteristics
Source Bacteroides vulgatus atcc 8482
Alias Ids YP_001300247.1 Molecular Weight 14624.88 Da.
Residues 126 Isoelectric Point 4.96
Sequence adddkpiqvnqlpqtaqtfikthfpdnkvamakmetdwfdksydviftngdklefdkkgiwtevnckysa vpvavvpdaikkyvatnypdakmlkierdkhdyevklsngweikfdmqfnvididn
  BLAST   FFAS   ProFunc   GPSS

Structure Determination
Method XRAY Chains 1
Resolution (Å) 1.85 Rfree 0.23321
Matthews' coefficent 2.15 Rfactor 0.19234
Waters 141 Solvent Content 42.69

Ligand Information
Ligands CAC (CACODYLATE) x 1
Metals

Jmol

 

Protein Summary


This protein (YP_001300247.1) is a putative periplasmic protein from Bacteroides vulgatus ATCC 8482, which is one of the most predominant microorganisms in the human gut. Based on the presence of a signalling sequence predicted by  TMHMM and SignalP with the  cleavage site between residues 20-21 it is believed to be secreted. The solved structure is the construct from amino acids 20-145 and has the signal sequence removed. There are no significant hits to this protein in PfamA.  It is similar to Pfam-B_56459 (E-value: 1.1e-52) and Pfam-B_102628 (E-value: 0.00011).

Its a first structural representative of a new (not listed in PFAM or CDD), large protein family (>100 members) present mostly in different species of Bacteroides and Campylobacters, , but also in Porphyromonas gingivalis (main agent of periodontal disease) and human oral and gut microbiome. Proteins in this family are annotated as putative periplasmic proteins and conserved hypothetical proteins, but none of them have been studied experimentally. FFAS detects similarity betweeen this family and an N-terminal domain from the  COG3212: Predicted membrane protein (FFAS score: -15.700. This is a much larger family (>400 memebers) with a (predicted) peptidase domain at the C-terminal.

YP_001300247.1 is present as a monomer in the asymmetric unit of the unit cell of the crystal structure. Crystal packing analysis suggests that the favored oligomeric form in solution should be a monomer.

GS13115A_Fig1.png

SSM results have very low scores. The top 2 hits have score with Q-value=0.19 and are with beta-lactamase inhibitory protein (BLIP), PDB ids 2b5r and 2g2w.

FATCAT produces some significant hits to BLIP (PDB code: 2g2u (exp=0.00105, same paper as 2g2w) and 2ogq (exp=0.00285)) by flexible alignment, as well as to a recently solved JCSG structure 3d4e (2.7A RMSD over 100 aa with 6% sequence ID).

Superposition of this protein with that of the 2g2u (green, Ref1, ~2.6A rmsd) shows their structural similarity (with a sequence identity of ~5%). The loops between the beta-strands in this protein are shorter than in the BLIP. The start of the N-terminal helix in the two proteins is also different. The amino acids from BLIP that are implicated in the interaction with beta-lactamase (W150, E31, D49, R160, Y115, W162, F142, K74 and Y143) are not conserved in this protein.

GS13115Amagenta_2GU2green.png

Superimposition with a portion of 2ogq (orange, Ref2, ~3.2A rmsd): This is the C-terminal regulatory domain (PB domain) of the Plk1 Polo-like kinase. The characteristic PB sequence of Plk1 is not conserved in this protein. The sequence identity between these two proteins is ~5%.

GS13115Amagenta_2OGQorange.png

    

Cacodylate from the crystallization condtion has been modeled in the structure.

References:

    

  1. Reynolds, K.A.,  Thomson, J.M.,  Corbett, K.D.,  Bethel, C.R.,  Berger, J.M.,  Kirsch, J.F.,  Bonomo, R.A.,  Handel, T.M. (2006) Structural and Computational Characterization of the SHV-1 beta-Lactamase-beta-Lactamase Inhibitor Protein Interface. J.Biol.Chem. 281: 26745-26753


  1. Garcia-Alvarez, B.,  de Carcer, G.,  Ibanez, S.,  Bragado-Nilsson, E.,  Montoya, G. (2007) Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization. Proc.Natl.Acad.Sci.Usa 104: 3107-3112

Ligand Summary

Reviews

References

 

No references found.

Classification

Classification

Files (0)

 
You must login to post a comment.
All content on this site is licensed under a Creative Commons Attribution 3.0 License

Powered by MindTouch Deki v.8.08