.
The Open Protein Structure Annotation Network
PDB Keyword
.

3db2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative NADPH-dependent oxidoreductase (ZP_01370612.1) from DESULFITOBACTERIUM HAFNIENSE DCB-2 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3db2 Target Id 379259
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS7168,DHAF_12NOV03_CONTIG1044_REVISED_GENE999, 335482 Molecular Weight 39424.80 Da.
    Residues 353 Isoelectric Point 5.44
    Sequence mynpvgvaaiglgrwayvmadaytkseklklvtcysrtedkrekfgkryncagdatmeallaredvemv iitvpndkhaevieqcarsgkhiyvekpisvsldhaqridqviketgvkflcghssrrlgalrkmkemi dtkeigevssieavfsnerglelkkgnwrgepatapggpltqlgvhqidnlqfllgpvarvfnfgkpmy tevenitvnqtllefedgkqaylgtnwacpgvfsinvygtkanlfyqldfswwsnsdvtdehstlikre fasmsddpdnrilrdvkvdfesvdhlrveveevadvirnggeteigaeaslrnlavvlaavksvhekrp veiaeiig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.174
    Matthews' coefficent 2.29 Rfactor
    Waters 598 Solvent Content 46.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3db2
    1. A novel _-N-acetylgalactosaminidase family with an NAD+-dependent catalytic mechanism suitable for enzymatic removal of blood group A antigens
    G Sulzenbacher, QP Liu, EP Bennett - Biocatalysis and , 2009 - informahealthcare.com
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The gene Dhaf_2064 from Desulfitobacterium hafniense dcb-2 encodes the YP_002458537 amino acid sequence with two domains: 1-120 belongs to the oxidoreductase family, NAD-binding Rossmann fold (PF01408); and 135-242  belongs to the oxidoreductase family, C-terminal alpha/beta domain (PF02894). SCOP classifies the N-terminal domain in the NADP-binding Rossmann fold superfamily and the C-terminal in the glyceraldehyde-3-phosphate dehydrogenase like C-terminal domain superfamily. YP_001273455, with 27% identical sequence, is annotated as a 3-chlorobenzoate-3,4-dioxygenase dyhydrogenase.

    3db2 structure is a a+b mixed protein with two beta sheets. There are three chains in the crystallographic asymmetric unit. However, the likely biological unit is a dimer (A+B and C+C association of the chains). According to DALI,  similar structures to 3db2 are: PDB:1evj (Z=36), PDB:1rye (Z=35), PDB:2glx (Z=38), 1h6a (Z=36) and JCSG structure PDB:1zh8 (Z=36, see topsan page) (Fig 3).



    FIg 1. 3db2 monomer architecture.




    Fig 2. The predicted biological unit is a dimer for 3db2.



    Fig 3. Similar structures (1evj 1rye 2glx 1h6a 1zh8) superimposed on 3db2 (in red).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch