.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d9r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of ketosteroid isomerase-like protein (YP_049581.1) from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043 at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3d9r Target Id 378184
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1713,YP_049581.1, 3.10.450.50, 103253 Molecular Weight 14468.57 Da.
    Residues 134 Isoelectric Point 4.59
    Sequence mskifneelavieaaaiayltafnradipaviatytddgvlmgpgrpaavgkdelaevylsvfetvgfd mayeikevvqtsadwafvrsategtetnkatgvvtpaayqelfllrksatgswqtaryctskisp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.219
    Matthews' coefficent 4.65 Rfactor 0.182
    Waters 215 Solvent Content 73.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Ketosteroid isomerase-like protein with an unknown ligand bound in a deep aromatic cleft containing conserved Tyr19, Glu110, and Tyr127. The UNL is at hydrogen bond distance from Thr91 and Thr129 (residues not conserved among its homologs). The most similar structures found with FATCAT server are: 3b8l, 3b7c, and 2rgq. This protein is encoded in the genomic neighborhood of uncharacterized protein that is similar to limonene-1,2-epoxide hydrolases. Both proteins belong to the same SCOP superfamily (NTF2-like, sunid: 54427).






    1). Relationship to other known JCSG structures
    PDB id 2ooc
    PDB id 2rfr
    PDB id 2b8l-structural similiarity to target described here.
    PDB id 2rgq



    Ribbon representation of the structure of 378184

    378184 belongs to the SnoaL-like polyketide cyclase Pfam family (PF07366). This family consists of several hypothetical bacterial proteins of around 125 residues in length. The function of this family is unknown. his family is a member of clan NTF2 (CL0051),


    Gene Neighbours
    %-tage 
     identity 
     Overlap  UniProt 
     ref. 
     Gene  
     name  
            Species         Protein name         Function 
     -   100.0%  132  Q6D750  -          Erwinia carotovora subsp         Putative uncharacterized protein.        
       -
     -   38.5%  117  A2QKZ2  -          Aspergillus niger         Similarity to hypothetical protein CAG74385.1 - Erwinia        
       -
     33.9%  112  Q394N1  -          Burkholderia sp         Putative uncharacterized protein.        
       -
     -   36.9%  130  A6UZT0  -          Pseudomonas aeruginosa PA7         Putative uncharacterized protein.        
       -
     37.0%  119  Q02SY4  -          Pseudomonas aeruginosa         Putative uncharacterized protein.        
       -
     -   31.9%  116  A6UZT2  -          Pseudomonas aeruginosa PA7         Putative uncharacterized protein.        
       -
     30.1%  123  Q02SY2  -          Pseudomonas aeruginosa         Putative uncharacterized protein.        
       -
     45.2%  42  B0R375  -                -         Putative uncharacterized protein.        
       -
     45.2%  42  Q9HS78  -          Halobacterium salinarium         Putative uncharacterized protein.        
    Proc:transport
    Comp:intracellular
     -   36.1%  72  Q846W8  -          Streptomyces cinnamonensis         Probable monensin biosynthesis isomerase.        
       -
     -   36.2%  58  A3ZWI9  -          Blastopirellula marina DSM 3645         Putative uncharacterized protein.        
       -
     40.4%  52  Q0B220  -          Burkholderia cepacia         Putative uncharacterized protein precursor.        
    Proc:transport
    Comp:intracellular
     -   36.0%  50  A0TER8  -          Burkholderia ambifaria MC40-6         Putative uncharacterized protein precursor.        
       -
     -   34.0%  53  A6BYN4  -          Planctomyces maris DSM 8797         Putative uncharacterized protein.        
       -

    spacerMatching Folds by SSM

     1                 6.861.35 15.4%  1dmnA Crystal structure of mutant enzyme y32f/y57f of ketosteroid isomerase from pseudomonas putida biotype b
     2                 6.461.36 17.9%  1c7hA Crystal structure of a mutant r75a in ketosteroid isomerase from psedomonas putida biotype b
     3                 7.061.36 15.4%  1gs3A High resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/ d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution
     4                 7.161.36 16.3%  1ea2A Pseudoreversion of the catalytic activity of y14f by the additional tyrosin- to -phenylalanine substitution(s) in the hydrogen bond network of delta-5-3-ketosteroid isomerase from pheudomonas putida biotype b
     5                 7.161.37 17.1%  1opyA Ksi
     6                 6.861.37 16.3%  1dmmA Crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b
     7                 6.861.38 16.3%  1dmqA Crystal structure of mutant enzyme y32f of ketosteroid isomerase from pseudomonas putida biotype b
     8                 6.371.77 17.1%  1jb2A Crystal structure of ntf2 m84e mutant
     9                 6.371.78 17.9%  1gy5A D92n,d94n double point mutant of human nuclear transport factor 2 (ntf2)
     10                 7.161.45 17.2%  1e3vA Crystal structure of ketosteroid isomerase from psedomonas putida complexed with deoxycholate




    Ligand Summary

    An unknown ligand (UNL) is modeled at the putative active site within each monomer of the asymmetric unit.

    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    dimer.png
    No description
    100.26 kB22:05, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch